SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G028794_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G028794_P01
Domain Number 1 Region: 132-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-22
Family B3 DNA binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G028794_P01   Gene: GRMZM2G028794   Transcript: GRMZM2G028794_T01
Sequence length 239
Comment seq=translation; coord=9:145600312..145602284:1; parent_transcript=GRMZM2G028794_T01; parent_gene=GRMZM2G028794
Sequence
MVAAAAETQWMSPYEVARERNVEENKRKMEALNLRHLSAVIKEAPKTPSPMKPKRRRPIE
DAVVVPSPPRRSRRLANLPELKYAEIAPHTADRMTRSPRKPACRIYFANRGSISMKARLE
ATRKAEELESELDHEIPSFVKAMLHSHVVRGFWLQLPSHFCDTYMPKQDSIITLVDEKDE
EFDTKYLAYKKGLSGGWAGFALCHGMQDGDSAVFQLIKPTTFKVYIIRAASDDVSEVDE
Download sequence
Identical sequences K7VPP2
XP_020400067.1.34533 GRMZM2G028794_T01|PACid:20836925 GRMZM2G028794_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]