SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G028980_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G028980_P01
Domain Number 1 Region: 119-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-48
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 774-858
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000399
Family PB1 domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G028980_P01   Gene: GRMZM2G028980   Transcript: GRMZM2G028980_T01
Sequence length 914
Comment seq=translation; coord=4:242084265..242090213:-1; parent_transcript=GRMZM2G028980_T01; parent_gene=GRMZM2G028980
Sequence
MKLSPSASGGLQDQPASPEEAEEHKCLNSELWHACAGPLVSLPSVGSRVVYFPQGHGEQV
AASTNKEMEAQIPNYPSLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDPFLP
AELGTASNQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFNQQPPAQELIAKDLH
GNDWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQT
VMPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPCEFVIPMAKYVKAVYHTRIS
VGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGEKQPRVSL
WEIEPLTTFPMYPSPFALGLKRPWPAGLPSLYGGRGDGLTSSLMWLRDRANPGFQSLNFS
GLGMSPWMQPRLDNSLLGLQSDMYQTIAAAAALQSTTKQVPPSAMQFQQPQNIADRSALL
SSQILQQVQPRFQQIYPQNLNENKIQGHTQPEYLQVQQQLQRCQSFNEQKPPMHPQQQQQ
EPQQQQCVQTPQDQQMQEQKHLHNFHSLPDALSAFSQLSPATHSPPSALQTVPAFSHQQN
FPDTNISSLSPSTGPSMHGMLGRLPSEAASSLPCVAMNAPVSVSDPWSSKRVAVESVNPC
RPHVSPHIEHLDMATCNMPQSSALAPLPGRECLVDEDGCSDPQNHLLFGVHIDSHSLLMQ
GGIPALQNDNSSGTIPYSTSNFLSPSENDFPLNQPLRSAGCLDESDYLPCAENAEQANQQ
FATFVKVYKSGTVGRLLDITRFSSYDELRSEVGRLFGLEGQLEDPLRSGWQLVFVDREDD
VLLVGDDPWQEFVNSVSCIKILSPEEVQRMGKPGIQLLSSAPSRRLGNGCDSYASMQEPR
GLDAGMAPVGSVEF
Download sequence
Identical sequences K7URZ7
GRMZM2G028980_P01 GRMZM2G028980_T01|PACid:20859406 NP_001333732.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]