SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G030710_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G030710_P01
Domain Number 1 Region: 158-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-43
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G030710_P01   Gene: GRMZM2G030710   Transcript: GRMZM2G030710_T01
Sequence length 736
Comment seq=translation; coord=6:164617307..164622572:1; parent_transcript=GRMZM2G030710_T01; parent_gene=GRMZM2G030710
Sequence
MAGIDLNDTVEEDEEEAEPGNACSQQSRTSSAATFPPPPPNQPRPSAAVCLELWHACAGP
VAPLPRKGSVVVYLPQGHIEHLGDAAAAGGGAPPPVALPPHVFCRVVDVTLHADASTDEV
YAQLALVAENEDVARRLRGRSEDGSAEDGDEGETVKQRFSRMPHMFCKTLTASDTSTHGG
FSVPRRAAEDCFPPLDYSQQRPSQELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSAFVN
KKKLVSGDAVLFLRGDNGELRLGVRRAAQLKNGSAFPALYNQCLNLGSLPNVAHAVATKS
VFHIYYNPRLSQSEFIIPFSKFIKSFSQPFSAGSRFKVKYESDDASERRCTGIIAGIGDA
DPMWRGSKWKCLMVRWDDDVDFRQPNRISPWEIELTSSVSGSHMSAPNAKRLKPCLPHVN
PDYLVPNGSGRPDFAESAQFHKVLQGQELLGYRTHDNAAVATSQPCEATNMQYIDERSCS
NDASNIIPGVPRIGVRTPLGSPRFSYRCSGFGESPRFQKVLQGQEVFHPYRGTLVDASLS
NSGFHQQDGSHVPTQASKWHAQLHGCAFRGQQAPAVPSQSSSPPSVLMFQRGDPKMSPFE
FGHFHVNKKEDRRAMFVHAGGIGGTEQTTMLQAHHVSGGTGNRDVTVEKSHPAVAAASDN
REVSKNSCKIFGISLTEKVPAMKEKGCGDINTNYPSPFLSLKQQVPKSLGNSCATVHEQR
PVVARVIDVSTVDMMI
Download sequence
Identical sequences A0A1D6MCU1
GRMZM2G030710_P01 XP_008649995.1.34533 GRMZM2G030710_T01|PACid:20819732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]