SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G035405_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G035405_P02
Domain Number 1 Region: 119-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-48
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000131
Family PB1 domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G035405_P02   Gene: GRMZM2G035405   Transcript: GRMZM2G035405_T02
Sequence length 913
Comment seq=translation; coord=5:41635542..41641630:1; parent_transcript=GRMZM2G035405_T02; parent_gene=GRMZM2G035405
Sequence
MRLSSSSGSVLPAQPGSPEAVEEHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQV
AASTNKEIESQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLNPQELKDPYLP
AELGSANKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPCQELMAKDLH
GNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQT
VMPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLVKYVKAVYHTRIS
VGMRFRMLFETEESSVRRYMGTITGICDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSL
WEIEPLTTFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLANSLMWLRDTANPGFQSLNFG
GLGMSPWMQPRLDATLLGLQPDMYQAMATAAFQDATKQASPTMLQFQQPQNIAGRASPLL
SSQILQQAHHQFQQQPYLQNISESTIQAQGQSEFLKQQIQRSQSFNEQKPQMQHQQESQQ
QQQPQCLPVPQHQQMQQQNMTNYQSISNALSPFSQLSPVSQSSPMALQTILPFSQAQSFT
DTNVGSLSPSNGNTMQNTLRPFSSEAVSHLSMPRPTAIPVADPWSSKRVAVESLLPSRPQ
VSSQMEQLDPAPASIPHSSALAPLPGRGCLVDQDVNSDPQNHLLFGVSIDSQSLLMQGGI
PGLQNGNDSAAIPYSTSNFLSPSQNDFPLDHTLNSSGCLDDSGYVPPCSDNSDKVNRPPA
TFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQLVFVDREEDVL
LVGDDPWQEFVSTVSCIKILSPQEVQQMGKQGLELLSSAPARRLGSSCDDYVSRQESRSL
STGIASVGSVELG
Download sequence
Identical sequences A0A1D6GSS0
NP_001333731.1.34533 XP_008644237.1.34533 GRMZM2G035405_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]