SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G051795_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G051795_P01
Domain Number 1 Region: 190-300
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000216
Family B3 DNA binding domain 0.011
Further Details:      
 
Weak hits

Sequence:  GRMZM2G051795_P01
Domain Number - Region: 28-99
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.000327
Family Metal cation-transporting ATPase, ATP-binding domain N 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G051795_P01   Gene: GRMZM2G051795   Transcript: GRMZM2G051795_T01
Sequence length 406
Comment seq=translation; coord=1:196370293..196371900:1; parent_transcript=GRMZM2G051795_T01; parent_gene=GRMZM2G051795
Sequence
MVDSRRSARARDDGARLHAATQEDYFLPFNFSPVDKCTALTACIDDGRCHRVSKGAPEQK
QIMTLRKCQEDVTNKVHATIDKHAERGLAVARQEVPEKRSKEDDGTGGPWQFVAPPLLPL
LDPPPTEDNGGSAQARPDVATSSKKKEERQNSAYSGAANMTRKRPCRHRVPDSITAVQHE
RLEALGATKPPRLMIGKSLMASDVDPKQARLLFSSKRDSLSQVTRVFTQTEMGLVRDRAG
LLVTAFDRDGRSYHLTCKYLESNSGYRFIAGWKAYVQDNGLGAAMRVDLWWFRSRKLHNR
YELRDGKEKVPFTVDSGHPDGSLGLVLLHYENDLPLPLPLPLPLPLPLPERAVEAPPPVQ
EAETRHMESKTTNTEEEVNAAIGLLMLSQNDDRSPRSMKRTRRTRK
Download sequence
Identical sequences A0A1D6KKT6
GRMZM2G051795_P01 GRMZM2G051795_T01|PACid:20871155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]