SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G056120_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G056120_P01
Domain Number 1 Region: 112-266
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-44
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G056120_P01   Gene: GRMZM2G056120   Transcript: GRMZM2G056120_T01
Sequence length 688
Comment seq=translation; coord=3:194771165..194777130:1; parent_transcript=GRMZM2G056120_T01; parent_gene=GRMZM2G056120
Sequence
MGIDLNMADGESQERRPPPAVCRELWHACAGPVVALPRRGSLVVYLPQGHLAAAGGGNVA
VDLPPHVACRVADVELCADAATDEVYARLALVAEGEAFGRNLRGGGVDGDDDMEDFDVER
KSRMLHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYNQLRPSQELVAKDLHGAKWKF
RHIYRGQPRRHLLTTGWSSFVNKKKLVSGDAVLFLRGDDGELRLGVRRAIQLKNEALFDD
FSCDSTKRHTLLAVADSLKHKSVFHISYNPRATASEYIIPHHKFLKSLNLPFCIGARINL
QCHNEDVSERRSGMVVHVSEIDPMKWPGSKWRSLLVRWEDGVECNGQDRVSPWEIEIAGG
SVSVAHSVSASSSKRTKLCPQGNLDVPTMYVTGNGNGCTDSVETGKFPRVLQGQDLMSFR
TRHVPSAPQTVEAAKLQSSGASRFLSNARGCALGGPTSRLAVHNSDFTYQSVGFNESIGF
SEVLQGQEISRAVPMFQGMMSEACSLKGGYGLHSYMRTPVAVTGLSATTQECSLTLSTPP
GAQVPSVYPDNIFNRTVVRQLGLASKFDGGATNAQQSVPFDRPREIWSKPQHEISDQTKM
DHFETRRASAPGDDAAKHGSGGEVVRKTSCRLFGFSLTEKILPADDDGIKEVTYEPECQN
PRMLDLFGYNCSAPSAALPALCAAPFGM
Download sequence
Identical sequences D9HNT8
GRMZM2G056120_T01|PACid:20827202 GRMZM2G056120_P01 XP_008673159.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]