SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G065478_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G065478_P01
Domain Number 1 Region: 10-101
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000412
Family B3 DNA binding domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G065478_P01   Gene: GRMZM2G065478   Transcript: GRMZM2G065478_T01
Sequence length 193
Comment seq=translation; coord=1:164914611..164917172:-1; parent_transcript=GRMZM2G065478_T01; parent_gene=GRMZM2G065478
Sequence
MQEHWSRMNKSIPEKFVSDPNGQLTETLSLKSPSGATWLVDVARNADADELLLGSGWGDF
ARAHELQEDDLVVFTRGGGGGSGSGCSFDVLVLDSSGCEKAPCFFAANKVHGRFSGGGRR
QAARRRVFRGPEPEGLGAQLRLAAAAASTHGASTSKQKCGETDKPSRAERFDIMKRDGCG
FNEIEAQARVSPL
Download sequence
Identical sequences XP_020402098.1.34533 GRMZM2G065478_T01|PACid:20870948 GRMZM2G065478_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]