SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G073750_P03 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G073750_P03
Domain Number 1 Region: 117-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-47
Family B3 DNA binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G073750_P03   Gene: GRMZM2G073750   Transcript: GRMZM2G073750_T03
Sequence length 781
Comment seq=translation; coord=3:120046865..120052020:-1; parent_transcript=GRMZM2G073750_T03; parent_gene=GRMZM2G073750
Sequence
MNLSPPRMSEPSLESDGEQRCLNSELWHACAGPLVSLPVVGSRVVYFPQGHSEQVAASTN
KEVDAQIPNYPNLPPQLICQLHNVTMHADAETGEVYAQMTLQPLSPEEQKEPFLPIELGA
GSNQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQHPPVQELVARDLHDNEWK
FRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRANRPQTVMPSS
VLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRF
RMLFETEESSVRRYMGTITCISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEP
LMAFPMYPTAFPLRLKRPWASGLPMFNGGRSDEFARYSSLMWLRDGNRGAQSLNFQGLGA
SPWLQPRIDYPLLGLKLDTYQQMAAAALEEIRAGDHLKQISSLLPVQQPQNLSGGLDPLY
GNPVLQQMQFQSQQSSLQVVQQGYGPNASDSGFLQNQLQLQKQQEPLPQQQQQALQQQSH
QEMQHHLSASCHDIANVASGVSESGSASQTESSLLSGSSYQQIYDGNSGPGLHLHNGFHN
CSSQESSNLLNLSRSGQFMASEGWPLKRLAVESLSGHELQPVQHKFEKVNHQSNVSHISS
TLPPLSARDSYSAQASGTNDQSHLLSSSFAIHDGLTAVRSGGVGSGTDAITIASLRYNDM
NLLPENPIATSSCLGESGTFNSLDDVCGVNPSQGGTFVKVCNLTYAVCSLFIKWHVKLPS
W
Download sequence
Identical sequences A0A1D6MWL0
GRMZM2G073750_T03|PACid:20830417 GRMZM2G073750_P03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]