SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G075906_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G075906_P01
Domain Number 1 Region: 215-601
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.81e-92
Family Regulator of chromosome condensation RCC1 0.00021
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-25
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 600-669
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.01e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G075906_P01   Gene: GRMZM2G075906   Transcript: GRMZM2G075906_T01
Sequence length 1054
Comment seq=translation; coord=8:151776059..151781549:-1; parent_transcript=GRMZM2G075906_T01; parent_gene=GRMZM2G075906
Sequence
MTPDENALITLKKGSKLIKYSRKGKPKIRSFRLSSDETALIWYSHKKEKFLRLSSVSKVI
PGQRTAVFRRFLRPEKDYLSFSLIYKNGQRSLDLVCKDQVEVEVWFSALEALISSCHRNS
SVDEHKDRVSFSDDVSYYRDGHPYDSTLDIASSISRSFNTADYCRGSSFSFRRSDAGSDR
ANMIRTSGADSTRLSISSAPSSSSQGSGTDDIESLGDVYVWGEVWTDAAPSDGHTSSSCS
KVDVLIPKPLESDVVLDVNQIVCGSRHVALTTRQGEVFTWGEELGGRLGHGTDTDISRPK
LVESLSVTIVDFISCGEFHTCAISASGDLFNWGDGSYRAGLLGYDTGASHWLPKRVSGPL
EGLQVLSVACGSWHSALITSTGRLYTFGDGKFGALGHGNRESAAYPKEVEALNGFRTVKV
ACGVWHSAAIVEASVQTGMNVVSKKLYTWGDGDKNRLGQGDKEARLIPTCLQALLEHNFH
QLGCGQNMTVALATSGHVYTMGSSDNGQLGNPKSDGKHPCLVKDKLANELVEEISCGAAH
VAVLTSRSEVYTWGLGANGRLGHGDLNDKKTPTIVEALKDRHVKSISCGSNFTTCICIHR
WVSGADQSVCTGCRQAFGFTRKRHNCYNCGLVHCHACSSRKVLKAALAPTPGKPHRVCDS
CFLKLKNADTSSSNANRRNAATRRSTDSREKPEIRPPRLVATPSAEPGKYMEVKASKSDM
KPADSIMKASQASALLQFKDLGFGAQFGGLQPMGMPPALAMSPAIPAFSLAPPSPYTKKM
KSPPTSAIPQSSKVDVDHLQKSNDLLNQEVLKLQSQVEDLKQKCEAQHEQLQKSDKKAKS
VASMATEESSKRNAAVEFVKFLDNELKGIADKLPVDVADSLKALQMRTQSLLREQSGHPL
ELVNPMERDHLHLSSGGSGRYDLVTHKSGGVGYLTMSQDGSSASGSAMSITSESPSHRFM
ENSSKAHGDFAPKQGTHGEVQLIEQFEPGVYVTLIQLKDGTKVFKRVRFSKRRFAENQAE
EWWRENQERVFKKYSHPTHAPHGNTTSHEEEHHS
Download sequence
Identical sequences K7VKT8
XP_008654599.1.34533 GRMZM2G075906_T01|PACid:20850891 GRMZM2G075906_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]