SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G077197_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G077197_P01
Domain Number 1 Region: 265-372
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.82e-16
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 2 Region: 45-190
Classification Level Classification E-value
Superfamily POZ domain 0.00000000228
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G077197_P01   Gene: GRMZM2G077197   Transcript: GRMZM2G077197_T01
Sequence length 583
Comment seq=translation; coord=3:5745506..5750346:1; parent_transcript=GRMZM2G077197_T01; parent_gene=GRMZM2G077197
Sequence
MEPMDSQLTALALSDSDSASVEGAAADAADADLQALRRLSDNLAAAFRSPDDFAFLADAR
IVVPGAPDLRVHRCVLCARSPFLRDAFARRAASAGEEEKDKDSYMCKVELRDLLGDEVEV
GYDALRLVLDYLYSGRVAALPKAACLCVDEDACAHVGCRPAVAFMAQVLFAASTFDVAEL
TNLFQRRLLDVLDKVEVDNLPLVLSVANLCSKSCVKLLERCLDVVVRSNLDMIALEKKLP
PDVVKEIVDARVSLGLVSPEDKGFPNIHVRRIHRALDSDDVELVRMLLKEGKTNLDDAYA
LHYAVEHCDSKITTELLDLALADVNHRNPRGYTVLHIAAMRREPKIIVSLLTKGARPSDL
TFDDRKAVQISKRLTKHGDYFGPTEDGKPSPKDRLCIEVLEQAERRDPQLGEASVSLAIE
GDSARGRLLYLENRVALARILFPMEARVAMDIAQVDGTLEFTLVSSVNLPAEIQRTVDLN
DTPFTMKEEHLARMRALSKTVEVGKRFFPRCSKVLDTIMDDEAEMASLGRDTSAEKKRRF
HDLQDLVQKAFSEDKEENDRSAARSPSSSSTTTTSIGAVRPRR
Download sequence
Identical sequences A0A1D6MHJ2
GRMZM2G077197_T01|PACid:20828192 GRMZM2G077197_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]