SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G081406_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G081406_P01
Domain Number 1 Region: 119-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-29
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G081406_P01   Gene: GRMZM2G081406   Transcript: GRMZM2G081406_T01
Sequence length 689
Comment seq=translation; coord=4:142909402..142912192:1; parent_transcript=GRMZM2G081406_T01; parent_gene=GRMZM2G081406
Sequence
MITFADLTEPAAAGAERCVDRQLWLACAGGMCTVPPVGASVYYFPQGHAEHALGLAGAAD
LSAARVPALVPCRVTAVRYMADPDTDEVFARIRLVPLRGGDADADAGGVEDDAAAADEQE
KPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYAADPPVQTVVAKDVHGAAWKFRHI
YRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFLRGDSGDLHVGIRRAKRGFCGAGGGGGDD
SPAAGWDHYAGLMRGNVSPCAAAKARGKVRPEDVAEAARLAAAGQSFEVVYYPRASTPEF
CVRAAAVRVAMRVQWSPGMRFKMAFETEDSSRISWFMGTVAGVQVTDPIRWPQSPWRLLQ
VTWDEPDLLQNVKRVSPWLVELVSSMPAIHLASFSPPRKKPRIPAYPEFPFEGQLLNPAF
PPNPLPHGQHHHHFLHSHSHQHHHPPFFPFPAGSAPAAIQGARHAQFVPPFSELHLTHLQ
PSLLYPRLRRPDHVGPTTPIPARVSTDLTIGGAAAAARDDDDDDFPCAPPSTGANRQKPD
AKPAGLVLFGRTILTEQQMSRSGATSPAATGNSSTCWNAEKGPNASEGSGGSGVIQTSPA
KAASSERPPWLGGDGSQQQQASGELGLGLEPGQCKVFVESDTVGRNLDLAALRSFDELYG
RLSGMFGVAGAELRSRVLYRGAAGDEPFR
Download sequence
Identical sequences GRMZM2G081406_T01|PACid:20861329 GRMZM2G081406_P01 XP_008678833.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]