SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G102938_P03 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G102938_P03
Domain Number 1 Region: 76-140
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000122
Family B3 DNA binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G102938_P03   Gene: GRMZM2G102938   Transcript: GRMZM2G102938_T03
Sequence length 190
Comment seq=translation; coord=6:57830583..57832040:-1; parent_transcript=GRMZM2G102938_T03; parent_gene=GRMZM2G102938
Sequence
MEVRGSAPSMKPKVEPPLEASHDWEVTPLSGDNPFFTSVMRKSQVQNPFQLVHIFFSFLF
PQSGTHARRSTPYCLFQVIPVRFHRHLPEARAPAVLLCRDRSWTVSYAGVGKWKRLQGAW
RDFARDNGLRLGDACVFELLVPSTDATQGDGDGSKDQGEVVFRVQVLRGGLPAEITSRGA
TSDDPLVIVD
Download sequence
Identical sequences B4FEU6 K0DCV9
GRMZM2G102938_T01|PACid:20820229 GRMZM2G102938_T03|PACid:20820230 NP_001131987.1.34533 GRMZM2G102938_P01 GRMZM2G102938_P03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]