SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G102938_P04 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G102938_P04
Domain Number 1 Region: 31-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.02e-18
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G102938_P04   Gene: GRMZM2G102938   Transcript: GRMZM2G102938_T04
Sequence length 164
Comment seq=translation; coord=6:57830596..57832040:-1; parent_transcript=GRMZM2G102938_T04; parent_gene=GRMZM2G102938
Sequence
MEVRGSAPSMKPKVEPPLEASHDWEVTPLSGDNPFFTSVMRKSQVQNPFQLVIPVRFHRH
LPEARAPAVLLCRDRSWTVSYAGVGKWKRLQGAWRDFARDNGLRLGDACVFELLVPSTDA
TQGDGDGSKDQGEVVFRVQVLRGGLPAEITSRGATSDDPLVIVD
Download sequence
Identical sequences B6TUV1
GRMZM2G102938_T02|PACid:20820231 GRMZM2G102938_T04|PACid:20820232 GRMZM2G102938_T05|PACid:20820233 GRMZM2G102938_P02 GRMZM2G102938_P04 GRMZM2G102938_P05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]