SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G106673_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G106673_P01
Domain Number 1 Region: 66-164
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-23
Family B3 DNA binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G106673_P01   Gene: GRMZM2G106673   Transcript: GRMZM2G106673_T01
Sequence length 171
Comment seq=translation; coord=4:26345030..26352720:1; parent_transcript=GRMZM2G106673_T01; parent_gene=GRMZM2G106673
Sequence
MEPVRRSGRLANLPDKPVYREKVPDFGMKIRRTYGSVRRDLTNRVYATDDARSYAISKAE
DLEQELDSSFPIFIKPMTQSHVTGGFWLGLPIHFCRKYLPKRDEMITLVDEDDDESDTLY
LAMKRGLSAGWRGFAVQQKLVDGDCLVFQLIEQTKFKVYITRASSYYESED
Download sequence
Identical sequences C0P906
GRMZM2G106673_T01|PACid:20856931 GRMZM2G106673_T04|PACid:20856932 GRMZM2G106673_P01 GRMZM2G106673_P04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]