SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G107481_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G107481_P01
Domain Number 1 Region: 145-230,371-508,581-600
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 7.98e-27
Family Calcium ATPase, transmembrane domain M 0.04
Further Details:      
 
Domain Number 2 Region: 226-297,329-367
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.58e-17
Family Calcium ATPase, transduction domain A 0.0078
Further Details:      
 
Domain Number 3 Region: 501-537
Classification Level Classification E-value
Superfamily HAD-like 0.0000192
Family Meta-cation ATPase, catalytic domain P 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G107481_P01   Gene: GRMZM2G107481   Transcript: GRMZM2G107481_T01
Sequence length 728
Comment seq=translation; coord=1:53248057..53251944:-1; parent_transcript=GRMZM2G107481_T01; parent_gene=GRMZM2G107481
Sequence
MRPERPLPPLPPSQETEEGVGAPGMDVPTRLPDPVASPILRHSSANSMRRTRSLRSLMAD
SPSVTFAANLRSGSKAESTASSLESFRFQRDGSASGTPAVFSRVSTRRSASERAGSQRDL
RDEDARFVYINDADRTNAPPAGLPDNSIHTTKYSVVTFLPRNLYEQFHRVAYLYFLVLVA
LNMVPQLGVFTPAASVLPLAFVLGVTAVKDAYEDWRRHRSDRNENNRTASVLVGGVFVPK
RWKEVQVGEVLRVVANETLPCDMVLLSTSDPTGVAYVQTINLDGESNLKTRYAKQETMPT
PPEALAGVIKCEKPNRNIYGFLATVDLDGRRAVSLGPSNIVLRGCELKNTTWAIGVAVYT
GRDTKVMLNSSGAPSKRSRLETRMNRETIILAVVLFVLCAIVSVLAGVWLGDHSDELGVI
PFFRKRDFSVKDDPDATYKWYGMGAEVAFTFMKSVIIFQVMIPIALYISMEIVRVGQAFF
MVQDRHMFDDKRQAKFQCRALNINEDLGQIKYVFSDKTGTLTENRMEFRCASVHGADFSD
TAGAGADDGHSVIGEDGVALRPKTAVKTDPELVALLKEGGGGASADRARDFLLTLATCNT
IVPIVVDDDDNDSAAAAARLLEYQGESPDEQALVYAAAAYGYTLVERTSGHVTVDVLGSR
QRADITEETYCMRMDAYNTPGPSTPAELWPARWSAVHEGPDTAFFQARELEMATGTNPLG
FAIPNLYP
Download sequence
Identical sequences GRMZM2G107481_P01 GRMZM2G107481_T01|PACid:20871241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]