SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G111123_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G111123_P02
Domain Number 1 Region: 148-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-22
Family B3 DNA binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G111123_P02   Gene: GRMZM2G111123   Transcript: GRMZM2G111123_T02
Sequence length 253
Comment seq=translation; coord=3:220340213..220343028:1; parent_transcript=GRMZM2G111123_T02; parent_gene=GRMZM2G111123
Sequence
MAEAVAVAYEEQRRRQIEMNKRKLEELQLHHLSAAVREAAAAAKPSSAKKRKAPVPRDAA
TEPPRRSDRLANLPEKPMYREVRVNLPFPEGSKSNARVPLDAANSVVVEPLRWSDRLANL
PKKPMYHEDSDEERSYAISKAEELVQELGSSFPIFTQPMTLSHVSGGFWLGLPKHFCREH
LPKSDETITLVDEEDDESDTFYLAMQAGLSTGWKEFAIQHKLLDGDCLVFQLIERTKFKV
YIIRATLYFESDH
Download sequence
Identical sequences B4FXE4 K0D9P9
GRMZM2G111123_T01|PACid:20829363 GRMZM2G111123_T02|PACid:20829364 GRMZM2G111123_P01 GRMZM2G111123_P02 NP_001141649.1.34533 XP_008672457.1.34533 XP_008672458.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]