SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G123461_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G123461_P01
Domain Number 1 Region: 18-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-18
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 199-268
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000412
Family B3 DNA binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G123461_P01   Gene: GRMZM2G123461   Transcript: GRMZM2G123461_T01
Sequence length 291
Comment seq=translation; coord=1:180528599..180529804:-1; parent_transcript=GRMZM2G123461_T01; parent_gene=GRMZM2G123461
Sequence
MASQGVVGGGGGGGGGGRHRFFKVLLPGSFEISLSLPPKFAAGLGVLCPAWRAAAKLRDR
TGRSWDVELRRDAGHHRVSFTGGGWRGFVSANALSAGQLLVFEHRGCLDFAVDRFDASGC
CCDDDQDGGGVVVAEHMATTTTTGTEATADKESGCSGQEAAAAVKRRRRSPLSTTTTVCG
GDDNDETLCRRIERAYQLRFLDLSKDFCDRVGWSSSRQVVLCAAGDSGKRWQVSVKVSAK
SGMMCAGWAEFAQDNGLTVSDACEFVPPPLHAHGSGSDVLQVHLVRGGGTS
Download sequence
Identical sequences A0A1D6KH04
GRMZM2G123461_P01 GRMZM2G123461_T01|PACid:20866241 XP_008662673.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]