SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G124371_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G124371_P01
Domain Number 1 Region: 220-607
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.72e-96
Family Regulator of chromosome condensation RCC1 0.00094
Further Details:      
 
Domain Number 2 Region: 6-116
Classification Level Classification E-value
Superfamily PH domain-like 5.82e-24
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 606-680
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.12e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G124371_P01   Gene: GRMZM2G124371   Transcript: GRMZM2G124371_T01
Sequence length 1056
Comment seq=translation; coord=2:23954827..23961138:-1; parent_transcript=GRMZM2G124371_T01; parent_gene=GRMZM2G124371
Sequence
MADPVDIDKALVALKKGTQLLKYGRKGKPKFIPFRLSNDESTLVWVSNNKDKSLKLASVS
RILSGQRTLVFQRFLLPEKDHLSFSLIYNDGKRSLDLICKNKVEAEAWFTGLSALICRGQ
HGSQVQHIDGIRIAGLPFDGARESSLSGSSTFTSDSFENKLSSVNSSKDRSSGEYTYSER
TDVSDMQVKSVSSSDIRISVSSALSTSSHGSGGEDSESFGDIYVWGEVICDTISRSGSDR
SAYSPGTTTDVLVPKPLESNVMLDVSYVACGVKHAALVTRQAEVFTWGEECSGRLGHGIG
TNVFQPRLVESLSTCNVELIACGEFHTCAVTATGDLYTWGDGTHNAGLLGHGSNVSHWIP
KRVSGPLDGLPVSAVSCGTWHTALITSSGQLYTFGDGTFGVLGHGNRASCSYPKEVESLK
GLRTISVSCGVWHTAAVVEVIISQSNASSGKLFTWGDGDKYRLGHGDRSSKLKPTCVPSL
IDYNFHKAACGHTLTIGLTTSGHIFTVGSPVYGQLGNPNNDGRYPRLVEEQLGGGGVVEV
ACGSYHVAVLTNAGEVYTWGKGTNGRLGHGDIADRKVPTLVEALKDRSVKRVACGSSFTA
AICQHKWVSGMEQSQCSACRQPFGFTRKRHNCYNCGLVHCHSCSSKKALRAALSPNPGKP
YRVCDSCYVKLSKVLDSGVSYSRNTIPRLPGDTKAERIDTKATRVAQSNSSDMIRNLDVK
AAKQTKKSEYSSQVPATLQLKDIPFISAPDLQNLSTVANQYPYDPRSTLPSLRMPYLNYS
SSMSSESSESLKDANELLKQEVQKLQAEVNSLRQEREQQDAELQKADAKAREAMNLATEE
ASKLKTAKDVINSLTAQLKEMSERLPPGACDVKNNGRVMGDLAPEMGREKQMRYGDRFSG
LPAQVYQTSNYSETAMVPPQGSSRSEHVDGVREFFSPVQQMANGGGSTTIGYRYRSDDHD
RRETDRFQINLQSLNTRSSNSPSNQVDAEWIEQYEPGVYLTLVSLRDGTKELKRVRFSRR
RFGEHQAESWWKDNCEKVYDKYNVCGTDRLSSVTTA
Download sequence
Identical sequences GRMZM2G124371_T01|PACid:20848079 GRMZM2G124371_P01 XP_008668207.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]