SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G126194_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G126194_P02
Domain Number 1 Region: 19-82
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000961
Family B3 DNA binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G126194_P02   Gene: GRMZM2G126194   Transcript: GRMZM2G126194_T02
Sequence length 103
Comment seq=translation; coord=10:109208124..109209099:-1; parent_transcript=GRMZM2G126194_T02; parent_gene=GRMZM2G126194
Sequence
MQVVPKSLAPFLPGTTVPATVTWHGRSWEMRFTGGRQIQRLEAGWRGFALDNGLKLGDGC
VFELVDGRAERVVFRVQVLRADIPAEIRERAGGYTSSSPILID
Download sequence
Identical sequences GRMZM2G126194_T02|PACid:20875817 GRMZM2G126194_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]