SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G128960_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G128960_P01
Domain Number 1 Region: 24-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-20
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G128960_P01   Gene: GRMZM2G128960   Transcript: GRMZM2G128960_T01
Sequence length 243
Comment seq=translation; coord=8:153373228..153375473:-1; parent_transcript=GRMZM2G128960_T01; parent_gene=GRMZM2G128960
Sequence
MNELDLNTAALDPDHYATGLRVLLQKELRNSDVSQLGRIVLPKKEAESYLPILMAKDGKS
LCMHDLLNSQLWTFKYRYWFNNKSRMYVLENTGDYVKAHDLQQGDFIVIYKDDENNRFVI
GAKKAGDEQTATVPQVHEHMHISAALPAPQAFHDYAGPVAAEAGMLAIVPQGDEIFDGIL
NSLPEIPVANVRYSDFFDPFGDSMDMANPLSSSNNPSVNLATHFHDERIGSCSFPYPKSG
PQM
Download sequence
Identical sequences GRMZM2G128960_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]