SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G133398_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G133398_P02
Domain Number 1 Region: 516-612
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-22
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G133398_P02   Gene: GRMZM2G133398   Transcript: GRMZM2G133398_T02
Sequence length 691
Comment seq=translation; coord=3:161572235..161577225:1; parent_transcript=GRMZM2G133398_T02; parent_gene=GRMZM2G133398
Sequence
MEASAGSSPPHSQENPPEHGGDMGGAPAEEIGGEAADDFMFAEDTFPSLPDFPCLSSPSS
STFSSNSSSNSSSAYTNTAGRAGGEPSEPASAGEGFDALDDIDQLLDFASLSMPWDSEPF
PGVSMMLENAMSAPPQPVGDGMSEEKAVPEGTTGGEEACMDASEGEELPRFFMEWLTSNR
ENISAEDLRGIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNHHLQRKRPRDVMEEE
AGLHVQLPSPVANPPGYEFPAGGQDMAAGGGTSWMPHQQAFTPPAAYGGDAVYPSAAGQQ
YSFHQGPSTSSVVVNSQPFSPPPVGDMHGANMAWPQQYVPFPPPGASTGSYPMPQPFSPG
FGGQYAGAGAGHLSVAPQRMAGVEASATKEARKKRMARQRRLSCLQQQRSQQLSLGQIQA
SVHLQEPSPRSTHSGPVTPSAGGWGFWSPSSQQQVQNPLSKSNSSRAPPPSLEAAAVAPQ
TKPAPAGARQDDIHHRLAAASDKRQGAKADKNLRFLLQKVLKQSDVGSLGRIVLPKKEAE
VHLPELKTRDGISIPMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGEFVRSNELQEGDFI
VIYSDVKSGKYLIRGVKVRPPPAQEQGSGSSGGGKHRPLCPAGPGRAAAAGAPEDAVVDG
VSGACKGRSPEGVRRVRQQGAGAMSQMAVSI
Download sequence
Identical sequences A0A1D6N3H6
GRMZM2G133398_T03|PACid:20827745 GRMZM2G133398_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]