SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G142999_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G142999_P01
Domain Number 1 Region: 29-147
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-30
Family B3 DNA binding domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G142999_P01   Gene: GRMZM2G142999   Transcript: GRMZM2G142999_T01
Sequence length 277
Comment seq=translation; coord=9:121281710..121282847:-1; parent_transcript=GRMZM2G142999_T01; parent_gene=GRMZM2G142999
Sequence
MEFTPAHAHARVVEDSERPRGGVAWVEKEHMFEKVVTPSDVGKLNRLVIPKQHAERYFPA
LDASSAAAAAAAAAAGGGKGLVLSFEDRAGKAWRFRYSYWNSSQSYVMTKGWSRFVKEKR
LGAGDTVLFARGAGGARGRFFIDFRRRRQDLAFLQPTLASAQRLLPLPSVPICPWQDYGA
SAPAPNRHVLFLRPQVPAAVVLKSVPVHVAASAVEATMSKRVRLFGVNLDCPPDAEDSAT
VPRGRAASTTLLQLPSPSSSTSSSTAGKDVCCLDLGL
Download sequence
Identical sequences K7WD32
XP_008660105.1.34533 GRMZM2G142999_T01|PACid:20839331 GRMZM2G142999_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]