SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G149940_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G149940_P01
Domain Number 1 Region: 302-400
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-17
Family B3 DNA binding domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G149940_P01   Gene: GRMZM2G149940   Transcript: GRMZM2G149940_T01
Sequence length 439
Comment seq=translation; coord=2:1669824..1676081:1; parent_transcript=GRMZM2G149940_T01; parent_gene=GRMZM2G149940
Sequence
MANANGSSTGAGHSDLVRAISHEQHQAFMASVPRAAPGGVNVHHQQHFHQYPAGLIPAPV
ALPVHAPVSSQTSPYSAQIAVPPPPPPLIASPDHRLHSLPPTGCYQLDYSPYGNAAAPSQ
QHTSAIRGFADWGTHSNALMSLAHATSFGNNGSSNINNNGLLHQNLSPYTTHTWTTTYVQ
RPYNTAVYAPATMNMLQTPPFHSNSHEKESGAVFSNSFNMAPSVTPTSPFQLMSPSSTNY
TSTQIFEETNNLEDTSRVFGGGDNESNNSEEPDPKPAVEMEDLNQGNDHTSNKTANCQDY
RMVLRKDLTNSDVGNIGRIVLPKKDAEPNLPILEDKDGLILEMDDFELPVVWNFKYRYWP
NNKSRMYILESTGEFVKRHGLQAKDILIIYRNKKSGRYVARAVKAEDIAPPECECVEAGN
PREECGFSVSPSINKKIIT
Download sequence
Identical sequences A0A1D6DTG4
GRMZM2G149940_P01 GRMZM2G149940_T01|PACid:20842517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]