SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G158162_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G158162_P01
Domain Number 1 Region: 367-470
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-21
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G158162_P01   Gene: GRMZM2G158162   Transcript: GRMZM2G158162_T01
Sequence length 963
Comment seq=translation; coord=7:167442138..167448973:-1; parent_transcript=GRMZM2G158162_T01; parent_gene=GRMZM2G158162
Sequence
MAMAGAGAAAAAAKRCMNPACGALPASSVVVGAGGDWRKGWPLRSGGFALLCDKCGLAYE
QFVFCDIFHQKESGWRDCSFCGKRLHCGCVASKNSYDLLDSGGIQCVTCMKNSAAQSASG
QVVPKLFPCPNNLLFFGKSDELLSSRKFEQPPSLMLDSRNDDIAIVNKSSHLFMVSGIEA
GQSSNILRQKEIENGPRQIKWEQPTLNIGDMGRPLLTRSQSALESPQCTRRDDNKDPTTD
STTSESFPEACLSMNLGIANNGNRMEATSTAERPMLSPTTAIAEGRELTTALSPFQHAQR
ARHFLTRPPRVGEGAAFDPTRDMFPHLRVARPPAEGRGRNQLLPRYWPRITDQELQQISG
DSNSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGRPLTIQDARGKEWHFQ
FRFWPNNNSRMYVLEGVTPCIQSLQLQAGDTVTFSRIDPGGKLVMGFRKATNTVSLPDSQ
ISAIANGSLLSETLFSTANESIGVVSGYPGFLHSIKGAADFHPSSLYDHHINSADGDVSW
NKADKFGSRPDEGSLQFLQKRSRNIGSKSRRFLIDAEDAMELKLTWEEAQELLRPAPTAK
PTVVMIEDYEFEEYDEPPVFAKRSIFTIRATGEQDQWIQCDECSKWRRLPLNVIVASKWT
CTDNSWDPKCCSCSAPEELTPKELQSVMQQYEEMRRRKGSYGLKLNVAEMDASSFDALAT
GAVFGEVGNQGTASVATTTRHPRHRPGCTCIVCIQPPSGKGPKHNPACTCNVCMTVRRRF
KTLMMRKKQRQSEREEAEASKKIAWVNRDEPEGSSLSRSPQTLDTTRDSSDVTMFDKVAA
DVNKGHIDLNFHPAAPAVRGAGDQGQNGAQQPRAVSMMGLLEVASRPLDNYMKQNGLTSL
AGEQGGGSSSTATVPPAPVESEDRTSDEGRVASAEREADAMAIDEAGENQQDKPADSAAA
AAT
Download sequence
Identical sequences C0P3Q8 K0DCR1
GRMZM2G158162_P01 GRMZM2G158162_P02 GRMZM2G158162_P03 NP_001168259.1.34533 XP_008651637.1.34533 GRMZM2G158162_T01|PACid:20835697 GRMZM2G158162_T02|PACid:20835698 GRMZM2G158162_T03|PACid:20835699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]