SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G159592_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G159592_P01
Domain Number 1 Region: 204-306
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-28
Family B3 DNA binding domain 0.0000218
Further Details:      
 
Domain Number 2 Region: 76-132
Classification Level Classification E-value
Superfamily DNA-binding domain 1.57e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G159592_P01   Gene: GRMZM2G159592   Transcript: GRMZM2G159592_T01
Sequence length 375
Comment seq=translation; coord=8:62996554..62997931:1; parent_transcript=GRMZM2G159592_T01; parent_gene=GRMZM2G159592
Sequence
MDSTSCLLDDASSGASTGKNKPAPVPAPAAVTGKPLQRVGSSGASAVMDAAEPGAEADSD
GARRAPGGVGGKLPSSKYKGVVPQPNGRWGAQIYERHQRVWLGTFTGEAEAARAYDVAAQ
RFRGRDAVTNFRPLAESDLDPDAAAELRFLASRSKAEVVDMLRKHTYGEELAQNRRAFAA
AAASLASPQLPPAKNTSPAAAREHLFDKTVTPSDVGKLNRLVIPKQHAERHFPLRRVQGG
RAPILSFEDAAGKAWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVGFYRSAAAGRQ
LFIDCKLRPKAVRLFGVDLLTEPPRSAAAVAQPEPEQEEIAVSKNKRARDAIAASATPVH
IAFKKQRVDVALTTT
Download sequence
Identical sequences K7UX20
XP_008656006.1.34533 GRMZM2G159592_P01 GRMZM2G159592_T01|PACid:20852281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]