SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G160005_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G160005_P01
Domain Number 1 Region: 117-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-44
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 955-1018
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000108
Family PB1 domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G160005_P01   Gene: GRMZM2G160005   Transcript: GRMZM2G160005_T01
Sequence length 1053
Comment seq=translation; coord=9:11006972..11019048:-1; parent_transcript=GRMZM2G160005_T01; parent_gene=GRMZM2G160005
Sequence
MKDHGSGGVTPSPAEGEKKPINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMHK
ELDTVPSYPSLPSKLICKLLSLTLHADSETDEVYAQMMLQPVNKYDRDAMLASELGLKQN
KQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFTMQPPAQELIAKDLHDISWKFR
HIYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFIRDEKSQLLLGIRRASRPQPALSSSVL
SSDSMHIGILAAAAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRML
FETEDSGVRRYMGTITGIGDLDPLRWKNSHWRNLQVGWDESTASERRTRVSIWEIEPVAT
PFYICPPPFFRPKLPKQAGMPDDENEVESAFKRAMPWLADDFALKDVQNALFPGLSLVQW
MAMQQNPQMLATASPAVQSQYLTSNALGMQDGIGSVSEDPTKRLTMQAQNIGLPNLQAGS
KVDHPAITPLAQHQQQPHHVLQQQQVQPLQQSSAILQQQQAQLLQQNAIHLQQQQEQLQR
QQSQPQQQFKATACLQSSDQHKLKEQQPSGGQAASQVHLLNQILQPSSSQLQQLGLPKSP
TQRPGLPSLTTMGSLQQSQLPQTPQPQQTAEYHQALLQSQQPQLQQLSQSELQLQLLQKI
QQQNLLSQLNPQHQSQLIQQLSQKSQEILQQQVLQHQFGGADAMGQLKHLQQTPLNHNTG
SLPPQQLVRSHSALTESEEPSSSTVPSGSRISPINSFSRANQGTRNLPEMPATPHIEHLL
QEIQSKTDNRIKNDIQGSKETVHAPNRHLASDQLDASSATSFCLDESPREGFSFPPVCLD
NNVQVDPRENFLIAENVDTLMPDALLSRGMSSGKGICNLPSGQRDHRDVENELSSAAFSS
QSFGVPDMSFKPGCSSDVAVADGGMASQGLWNSQTQRMRTFTKVQKRGSVGRSIDITRYR
GYEDLRHDLACMFGIQGQLEDPYRTDWKLVYVDHENDILLVGDDPWEEFVSCVKSIKILS
SVEVQQMSLDGDLGCIPQTQACSASDDANAWRA
Download sequence
Identical sequences D9HNV4
GRMZM2G160005_T01|PACid:20837947 GRMZM2G160005_P01 XP_008659167.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]