SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G160224_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G160224_P01
Domain Number 1 Region: 2-47
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000628
Family B3 DNA binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G160224_P01   Gene: GRMZM2G160224   Transcript: GRMZM2G160224_T01
Sequence length 48
Comment seq=translation; coord=1:25700051..25702632:1; parent_transcript=GRMZM2G160224_T01; parent_gene=GRMZM2G160224
Sequence
MRGRSWTVSLKRGKRLLGDRSAFKYGWHKFCVDNNLEVGDVCFFRVIR
Download sequence
Identical sequences GRMZM2G160224_P01 GRMZM2G160224_T01|PACid:20861858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]