SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G174610_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G174610_P02
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-19
Family B3 DNA binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G174610_P02   Gene: GRMZM2G174610   Transcript: GRMZM2G174610_T02
Sequence length 133
Comment seq=translation; coord=6:154788273..154793267:1; parent_transcript=GRMZM2G174610_T02; parent_gene=GRMZM2G174610
Sequence
MVRSHVSSCFWLGLPISFCKNNLPSKEFRMVLEDEEGLEFDAVYIGNRTGLSGGWRGFAM
HHNLEEGDSLVFELAEHDKFKIYIIKAIDDDVKEAEPDDKNDNGVTKEEPDQEESPVAEP
PKGAKRRKLRGRR
Download sequence
Identical sequences C0PJB5
GRMZM2G174610_T02|PACid:20823525 GRMZM2G174610_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]