SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G174949_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G174949_P01
Domain Number 1 Region: 202-588
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.31e-96
Family Regulator of chromosome condensation RCC1 0.00071
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-24
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 3 Region: 587-661
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.49e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  GRMZM2G174949_P01
Domain Number - Region: 783-859
Classification Level Classification E-value
Superfamily Tropomyosin 0.00719
Family Tropomyosin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G174949_P01   Gene: GRMZM2G174949   Transcript: GRMZM2G174949_T01
Sequence length 1009
Comment seq=translation; coord=6:162233912..162239658:-1; parent_transcript=GRMZM2G174949_T01; parent_gene=GRMZM2G174949
Sequence
MTPDDNALIALKKGSKLIKYSRKGRPKIREFRLSSDETSLVWYSHSKVKYLVLSSVSRII
PGQRTAVFRRFLRPEKDYLSFSLIYKNGQRSLDLVCKDQAEVEVWFSTLEALITSCRKSY
SADGPSDRLSVSDEVSHYQDTFHDTTLDIASSITRTFNSAKTDVVSDRANMLRASTDSSR
LSISSAPSSSSQGSGQDDIESLGDVYVWGEVWTDMIPAEGSANYLCSKADILIPKPLESD
VVLDVQQIACGYRHIALTTRQGEVFAWGEELGGRLGHGTDADISRPKLVEALAVSNVEYV
ACGEFHTCAITASGDLYTWGDGYYNAGLLGHGAGTSHWLPKRVSGPLEGVQVLSVSCGSW
HSALTTSSGKVFTFGDGTFGALGHGNRHTVAYPKEVETLSGFRTIKVACGLWHSAAIVET
TNQAGVNVISRKLFTWGAGDKNPLGHGDKDARLVPTCVQSLIDYNFHQVACGHSMTIALS
TSGHVFTMGSSSNGQLGNPKSDGKHPTPVQDRLAGELVEEISCGSCHVAVLTSRSEVYTW
GMGANGRLGHGGVEDKKKPTLVEALKDRHVKSIACGSNFTTCICIHKWVSGADQSVCSGC
RQPFGFTRKRHNCYNCGLVHCHACSSKKVLKAALAPTPGKPHRVCDSCFMKLKAAETSSN
SSHSKRNAIARRSVDSKDRSERPEIRSSRLATGSTAEPLKQAELKAVRNEIKPDPMSTMR
APQVPSMLPFNNLAFGATFGGPASLKPMTMAPMPMAMPMSPAPLTKKPTPAAATPLCGKS
DTDNLKMAKQVLNEDISKLQSQVNKLKQKCDAQEEQLQKAERRAEHSASTAAEESSRRNG
VLEFIRFLDNELKSIADRVPSDAADGLKALQNHSERFLTEQGVRPLEATGMHRKCASIGN
LVMSQDGSAGNASSSAASLASESPCHRIMENSSRANGDLAPKLGGTHGEVQLIEQFEPGV
YVTLIQLRDGTKVFKRVRFSKRRFAEQQAEEWWRENQERVFRKYNHPAN
Download sequence
Identical sequences A0A1D6MBL7
GRMZM2G174949_P01 XP_008649951.1.34533 XP_008649952.1.34533 XP_008649953.1.34533 XP_008649954.1.34533 XP_008649955.1.34533 XP_008649956.1.34533 GRMZM2G174949_T01|PACid:20820517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]