SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G317900_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G317900_P01
Domain Number 1 Region: 129-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.32e-43
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 1031-1098
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000216
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G317900_P01   Gene: GRMZM2G317900   Transcript: GRMZM2G317900_T01
Sequence length 1152
Comment seq=translation; coord=5:56732754..56740115:1; parent_transcript=GRMZM2G317900_T01; parent_gene=GRMZM2G317900
Sequence
MIKQQQQQAPPAPAPAAAPPPSACEGEKKAPPINSELWHACAGPLVSLPPAGSLVVYFPQ
GHSEQVAASMQKDVDGHVPSYPNLPSKLICLLHNVTLHADPETDEVYAQMTLLPVTSYGK
EALQLSELALKQPRPQTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEI
QARDLHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLLAGDSVIFVRDEKQQLLLGTRR
ANRQPTNISSSVLSSDSMHIGILAAAAHAAANNSPFTIFYNPRASPTEFVVPFAKYQKAL
YGNQISLGMRFRMMFETEELGTRRYMGTITGISDLDPVRWKNSQWRNIQVGWDESAAGER
RNRVSIWEIEPVAAPFFICPPPFFGSKRPRQLDDESSEMENLLKRAMPWLGEEICIKDPQ
TQNTIMPGLSLVQWMNMNMQQNSFANSAMQSEYLRSLSNPNMQNLGVADLSRQLNLQNQI
LQQNSIQFSSPKLPQQMQLANELSKASLPLNQIGVGTKPQEQTQDPNNLQRQQQSMNQLL
PLSQSQTNLVQAQVLIQNQMQQQKQPTSMAQNQQPAASQSLILPQQQQQQQQHQQQKLVH
QQQQILLQQQQLQQQQQLQQQQQNQQQLNKMAAQMPNLASHQPQLSDQQLQLQLLQKLQQ
QQQSLLSQPAVTLAQLPLIQEQQKLIIDMQQQLSNSQPLSQQQTMPQQSIQVPSRATPPP
TTTVQQESQQKLPQKHVGFTDTSHTTIPPTTSVNTISVVGSPLMATGATHSVVTDEIPSC
STSPSTANGNHIVQPVLGRNQLCSMINYEKVPQSTPMSIPSSLEAVTATPRSIKELPKLN
SNVKQSVMASKLPNAGHVAQNLTNNAPPTDYPETASSATSVWLSQADGLLHHSFPMSNFN
QQQQMFKAAAPETDIQGADPSNNTLFGINGDGQLGFPMGADDFLSNGIDASKYQGHISTD
IDGNYRISKDGQQEISSSMVSQSFGASDMAFNSIDSGMNDGGFVNRTSWPPAPPLKRMRT
FTKVYKRGAVGRSIDISQFSGYDELKHALARMFSMEGQLEERQRIGWKLVYKDHEDDILL
LGDDPWEEFVNCVKCIRILSPQEVQQISLDGDLGNNILPNQACSSSDGGNAWRARCDQNS
GNPSTGSYDQFE
Download sequence
Identical sequences A0A1D6GVF9
XP_008645044.1.34533 GRMZM2G317900_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]