SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G318527_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G318527_P01
Domain Number 1 Region: 225-606
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.88e-88
Family Regulator of chromosome condensation RCC1 0.00059
Further Details:      
 
Domain Number 2 Region: 609-677
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.49e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 14-93
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000676
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G318527_P01   Gene: GRMZM2G318527   Transcript: GRMZM2G318527_T01
Sequence length 1044
Comment seq=translation; coord=2:14641925..14649273:1; parent_transcript=GRMZM2G318527_T01; parent_gene=GRMZM2G318527
Sequence
MAGSFDLRTPTRGVEQAIVALKKGAHLLKCGKRGKPKFCAFRISSDETTLIWYSKGREKH
LSLSSVSAVVLGQKTICSDRDQAENWYLGLRALLPTPCNPCSSIESRSSRQIDSCTNTPS
SYIQLKSKLLSVHGTPRHIQVCSSQRKPKKAHGTFFGGSADCSESLFYTRQRTFSDIGTY
LENLTRKMSNPEIHDLKDVMVGNQEKEQKITQTPKLKTFEGPRAACRLDSLKDVFFWGDA
FGSILECGDTSKPLPMLVDSTNMLDVQSIACGETHAAIITKQGEVYSWGNESSGRIGNQV
NIKVSRPKVVQSLASLHVKDVAYGSKHTCAVTVSGELIEWGEGPYMGQLDSYARNQWFPH
KLFSPLDGISVVKIACGPWHTAIITSSGQLYTYGDGTFGVLGHGDTQGTTRPKEVESLKG
SRVKCVACGPWHTAAIVEVISDFKSNSPRSKLFTWGDADRGKLGHADKKMKLIPTCVDSL
TDYDFIQVSCGTALTVALSVTGVVFTSGSSMHGQLGNPHADGKTVSAVEGLLKSEFVRHI
SSGSSHVAVVTTNGKVFTWGKGKEGQLGLGDFLNRSTPTLVDALEGRHVESLSCGYNYTA
AVCLHKVISRKDLSVCSGCKMAFGFTRKKHNCYHCGSMFCNSCSSNKVAKAALAPDKSRR
YRVCDGCFSQLLKVVDSGKVKSELNTSKGAEIIRSYTPKLSRIFRDVNLPVEKEKVALVQ
RSNQRNEVLYTPVQAKSQRWGQVECPAQFLSAEDSSHYQSISKNHMYSASVSERMHDPTV
LKSGRSLQQPNDDQRKDLNSIEETLLTEEVKQLRSQMTLLMEQYHQKALQVELYKQKLDE
TWLIVRNEAAKCKAAKDIIKVLTDQCKALSEKLLVGQQYENLETKSNISQGQTFSADLQH
HPSEKFATGKFGQLDNTKNHQTSSQGDEEYTPSSSSDVQVEGLCGHLNGSRTFDSNGRIT
EGNSIVARVTSNGVIEQIERGVYVTFAVSPCGKKDIKRVRFSRKHFGEKEAQHWWEENKG
SVYAKYSTEKAQHQLEVTIKSVQE
Download sequence
Identical sequences GRMZM2G318527_P01 GRMZM2G318527_T01|PACid:20844141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]