SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G319130_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G319130_P01
Domain Number 1 Region: 305-696
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.16e-96
Family Regulator of chromosome condensation RCC1 0.001
Further Details:      
 
Domain Number 2 Region: 19-85,125-166
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-20
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 3 Region: 695-765
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.55e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  GRMZM2G319130_P01
Domain Number - Region: 915-976
Classification Level Classification E-value
Superfamily Tropomyosin 0.0213
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G319130_P01   Gene: GRMZM2G319130   Transcript: GRMZM2G319130_T01
Sequence length 1131
Comment seq=translation; coord=8:156666918..156675049:1; parent_transcript=GRMZM2G319130_T01; parent_gene=GRMZM2G319130
Sequence
MSDVSLDLGGIRAGPVERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFS
GKEEKHLRLSHISKIIPGQRTLNSIVNEQKLYVSLEVFPFSIRDEIGCLTLLTRPFFIIQ
SIFQRYPRPEKECQSFSLISHDRSLDVICKDKDEAEVWFAGLKTLISRCHQRKWRTESRS
DLLSSGATSPRTYTRRSSPLSSPFSSNDSIHKDGSDNYRLRTPYGSPPKNGLEKAFSDVM
LYAVPPRGFFPSDSNAGSVHSMSSGHSDNTNGHPRGVPMDAFRASYSSAVSSSSHGSGHD
DGDALGDVFIWGEGTGEGILGGGGSRVGSSSGAKMDCLVPKPLEFAVRLDVQNISCGGRH
AALVTKQGEIYSWGEESGGRLGHGVDCDVSQPKLIDALSHMNIELVACGEYHTCAVTLSG
DLYTWGDGTFKFGLLGHGNDISHWVPKHVNGPLEGIHVSSISCGPWHTAVVTSAGQLFTF
GDGSFGVLGHGDRESISVPREVESLKGLRTVRAACGVWHTAAVVEVMAGNSSSSNCSSGK
IFTWGDGDKGRLGHGDKGPKLVPTCVAALVEPNFCQVACGHCLTVALTTSGHVYTMGSAV
YGQLGNAQADGMLPVRVEGKLHKNFVEEISCGAYHVAVLTSKTEVYTWGKGANGRLGHGD
TDDKNTPTLVEALKDKQVRIVVCGINFTAAICIHKWVSGVDQSMCSGCRQPFNLRRKRHN
CYNCALVFCHSCSSKKSLKASLAPNTNKPYRVCDTCYSKLTKGLETDMHSSAKRAATVPG
VSDANEEDLETRSNAQLSRLSSMESFKHLDSRYSKKNKKFEFNSTRVSPVPNGSSHWSGL
NISRSFNPVFGSSKKFFSASVPGSRIVSRATSPISRRASPPRSTTPTPTLGGLTSPRVVP
NDGKPTNDALSQEVLNLRSQVESLARKSQLLEVELERTTKQLKEAISIAGEETAKCKAAK
EVIKSLTAQLKGMAERLPGGAAKNTKLPPLPGIFIPSDIPSMPTESEGSPSSSGEQIING
HNGLLTSNGQSSIRNKTSHPEVGKNGGRLPDAESCHDAEWVEQDEPGVYITLTALPGGAR
DLKRVRFSRKRFSETQAEQWWQQNRARVYQQYNVRVIDKSTASVNSDIAAN
Download sequence
Identical sequences GRMZM2G319130_P01 GRMZM2G319130_T01|PACid:20849198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]