SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G328742_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G328742_P01
Domain Number 1 Region: 40-144
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.41e-26
Family B3 DNA binding domain 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G328742_P01   Gene: GRMZM2G328742   Transcript: GRMZM2G328742_T01
Sequence length 307
Comment seq=translation; coord=4:195521365..195523397:-1; parent_transcript=GRMZM2G328742_T01; parent_gene=GRMZM2G328742
Sequence
MATNHLSQGQHQHPQAWPWGVAMYTNLHYHHQQHHHYEKEHLFEKPLTPSDVGKLNRLVI
PKQHAERYFPLSSSGAGDKGLILCFEDDDDDEAAAANKPWRFRYSYWTSSQSYVLTKGWS
RYVKEKQLDAGDVVRFQRMRGFGMPDRLFISHSRRGETTATAATTVPPAAAAVRVVVAPA
QSAGADHQQQQQPSPWSPMCYSTSGSYSYPTSSPANSQHAYHRHSADHDHSNNMQHAGES
QSDRDNRSCSAASAPPPPSRRLRLFGVNLDCGPGPEPETPTAMYGYMHQSPYAYNNWGSP
YQHDEEI
Download sequence
Identical sequences B4FEK2 K4JBU6
GRMZM2G328742_P01 NP_001131920.2.34533 GRMZM2G328742_T01|PACid:20856938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]