SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G338259_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G338259_P01
Domain Number 1 Region: 123-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-39
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 684-768
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000162
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G338259_P01   Gene: GRMZM2G338259   Transcript: GRMZM2G338259_T01
Sequence length 822
Comment seq=translation; coord=3:155257522..155263501:-1; parent_transcript=GRMZM2G338259_T01; parent_gene=GRMZM2G338259
Sequence
MPPATAMAPPSQPPSNSGDPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQVEASMNQ
VAGNQMRLYDLPPKLLCRVLNVELKAETDTDEVYAQIMLMPEPEQTDVPAEKPSSAPAAS
PRPAVRSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMTQSPPTQELVAKDLHGMEWRF
RHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQLSNVPSSV
ISSQSMHLGVLATAWHAINTKSMFTVYYKPRTSPSEFIIPYDQYMESVKNNYSIGMRFRM
RFEGEEAPEQRFTGTIVGCENLDPLWPDSSWRYLKVRWDEPSTIPRPDRVSPWKIEPASS
PPVNPLVHSSRAKRPRQNVPPPSLESSVLTKEGATKVEIDSAQTQHQNSVLQGQEQMTLR
NNLTESADSDSTVQKPMMWSPSLNGKAHTHFQQRPAMDNWMPLGRRENDFKDTRSAFKDA
RTASQSFGDTQGFFVQAYDDNHHRLSFKNQGSTHRFADPYFYMPQQSSVTVESSTRTQTA
NNDLCFWGDQNAMYGNPSDQQQGFNFGQNPSSWLNQPFPQVEQPRVVRPHATVAPFDLEK
TREGSGFKIFGFQVDTTSPSPVQLSSPLPAIQEHVLQTRPSAPVNELQPVQIECLPEGSV
STAGTATENIQQAPQSSKDIQSKSQGASTRSCTKVHKQGVALGRSVDLSKFTDYGELQAE
LDKMFDFEGELVSGSQNWQIVYTDDEGDMMLVGDDPWEVLQHSAQDLHLHEGGGPEDELE
ISCAKEGGISGSGRRRRLRRRHKRVRKAKGKCIEGKASGGWS
Download sequence
Identical sequences GRMZM2G338259_P01 GRMZM2G338259_T01|PACid:20831574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]