SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G338259_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G338259_P02
Domain Number 1 Region: 123-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-39
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 684-767
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000736
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G338259_P02   Gene: GRMZM2G338259   Transcript: GRMZM2G338259_T02
Sequence length 805
Comment seq=translation; coord=3:155258353..155263217:-1; parent_transcript=GRMZM2G338259_T02; parent_gene=GRMZM2G338259
Sequence
MPPATAMAPPSQPPSNSGDPLYPELWRACAGPLVTVPRVGDLVFYFPQGHIEQVEASMNQ
VAGNQMRLYDLPPKLLCRVLNVELKAETDTDEVYAQIMLMPEPEQTDVPAEKPSSAPAAS
PRPAVRSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMTQSPPTQELVAKDLHGMEWRF
RHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQLSNVPSSV
ISSQSMHLGVLATAWHAINTKSMFTVYYKPRTSPSEFIIPYDQYMESVKNNYSIGMRFRM
RFEGEEAPEQRFTGTIVGCENLDPLWPDSSWRYLKVRWDEPSTIPRPDRVSPWKIEPASS
PPVNPLVHSSRAKRPRQNVPPPSLESSVLTKEGATKVEIDSAQTQHQNSVLQGQEQMTLR
NNLTESADSDSTVQKPMMWSPSLNGKAHTHFQQRPAMDNWMPLGRRENDFKDTRSAFKDA
RTASQSFGDTQGFFVQAYDDNHHRLSFKNQGSTHRFADPYFYMPQQSSVTVESSTRTQTA
NNDLCFWGDQNAMYGNPSDQQQGFNFGQNPSSWLNQPFPQVEQPRVVRPHATVAPFDLEK
TREGSGFKIFGFQVDTTSPSPVQLSSPLPAIQEHVLQTRPSAPVNELQPVQIECLPEGSV
STAGTATENIQQAPQSSKDIQSKSQGASTRSCTKVHKQGVALGRSVDLSKFTDYGELQAE
LDKMFDFEGELVSGSQNWQIVYTDDEGDMMLVGDDPWEEFCSIVRKIYIYTKEEVQKMNS
KSAAPRKEESPAAGGGGGCAAATNE
Download sequence
Identical sequences A0A1D6N2H0
GRMZM2G338259_T02|PACid:20831575 NP_001307056.1.34533 GRMZM2G338259_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]