SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G352159_P05 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G352159_P05
Domain Number 1 Region: 131-238
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-35
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 646-719
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000137
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G352159_P05   Gene: GRMZM2G352159   Transcript: GRMZM2G352159_T05
Sequence length 771
Comment seq=translation; coord=3:87617291..87623545:1; parent_transcript=GRMZM2G352159_T05; parent_gene=GRMZM2G352159
Sequence
MAAAACAGAEAGRGCGGKDALFVELWKACAGPLSCVPPLGEKVYYLPQGHIEQVEASTNQ
LAEQQGTPLYNLPWKIPCKLMNIELKVEPDTDEVYAQLTLLPDKKQDENTSTTVEEEEVV
VPPALPATNEGPHIHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSQHPPNQELVAK
DLHGAEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRTSPAEFVVSRDRYYE
SLKRNYSIGMRFKMRFEGEEAAEQRFTGTIVGIGASDPSGWADSKWRSLKVRWDEPSSIS
RPERVSPWQIEPSVSPCHVNPLPVRFKRSRSSVNALPSDVSTVTREVMADSQQNSLTRAL
HNQGRTQLTVRYHDNSDVKTTQDLTVWSSGTEQQRNNIAAQTKLCLEGWTPTRSPEGYNQ
IFSAFKPLKDIHNPLGPFPSQISGTHSNSWDTADARYPVQQANYSMLPGTWSLRPHNSGF
RMNQQNYLVMPEGANFTGKSAFTSLQDHGTDKCSTGCFGHIESSSHTDHASSSLIRPQPL
VLGNGVQKSKGTSFKLFGIPLGSPEKSEPLVSPPSVAYDGKLQTSPSEKGNQLDVVEVDN
CSHPSKTVKPLDGPQSDSITENNQPSPEATLNIQNKVQSSSTRSCKKVHKQGSALGRSID
LTKFACYDELIAELDQMFDFDGELKSPCKSWLVVYTDNEGDIMLVGDDPWNEFCDMVHKI
FIYTREEVERMNPGALNSRSEDSLSDSLGRGVASRDPRGGGSTSALDSENC
Download sequence
Identical sequences GRMZM2G352159_T05|PACid:20829403 GRMZM2G352159_P05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]