SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G369356_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G369356_P01
Domain Number 1 Region: 111-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.03e-28
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G369356_P01   Gene: GRMZM2G369356   Transcript: GRMZM2G369356_T01
Sequence length 513
Comment seq=translation; coord=2:25343713..25348635:-1; parent_transcript=GRMZM2G369356_T01; parent_gene=GRMZM2G369356
Sequence
MGPQPPLHLPAANGDSIVDRDVWLACAVPLSRLPAVGAEVYYFPHGHAEQCPAHLPAPLP
APHLFPCTVAGVSLGADDETNEVFAKISLSPGPHRGPAAACRTDPTSDCPPQELSYFTKE
LTQSDANNGGGFSVPRYCADHIFPTLDFDANPPVQKLFMRDTRGNPWQFRHIYRGTPRRH
LLTTGWSRFVNAKLLVAGDIVVFMRRHNGDLIVGLRRTPRYPLVFPRVGSGAGVDPDQPP
PRNARARVPPQDVIEAARLAAEGRSFAVTYFPRQAAGEFIVPRDEVEGVLATRWEPGAQV
RMQVMEAEDTRRTVWADGHVKSLHQNIWRALEIDWDDSSPLSPNLSRFVNAWQVELVTHP
PLPNGARICNPIASLCHGDVSYPLIGSEIQGPPIPASMQGARHTGPCAAPSESSAVLTNR
VLFPLLNPDLQMPPFTSPSDSSEILDPESASPPNKSVRLPPAELPVQVKSIQLFGATIMV
HVVRSVACGGCCEELNGAPSGDATADGSVGKDV
Download sequence
Identical sequences C0PGA8 K0DCT2
GRMZM5G808366_T01|PACid:20847883 GRMZM2G369356_P01 NP_001169598.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]