SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G378580_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G378580_P02
Domain Number 1 Region: 142-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.67e-40
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 717-792
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000288
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G378580_P02   Gene: GRMZM2G378580   Transcript: GRMZM2G378580_T02
Sequence length 849
Comment seq=translation; coord=4:23392179..23398028:-1; parent_transcript=GRMZM2G378580_T02; parent_gene=GRMZM2G378580
Sequence
MTSSAAAAAAAAQVAGGGGGGEGDAAAAARGGGGTEDGMYTELWNLCAGPLVTVPRVGDK
VYYFPQGHIEQVEASTNQVAEQHMQFYDLPWKILCEVMNVELKAEPDNDEVYAQLTLLPE
SKPEENGSSEEMPASPPAALARPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMT
RQPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRGDSG
ELRVGVRRAMRQQANVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRTSPAEFVVP
CDRYMESLKRNYPIGMRFKMRFEGEEAPEQRFTGTIVGNVDPDQAGWAESKWRYLKVRWD
EASSIPRPERVSPWQIEPAVSPPPINPLPVHRPKRPRSNAVASLPESSAPTKEAAPKVTL
ETQQHALQRPLQTQDNVAPKSVFGDNSELDSAHKSSLRPSGFDLDKSTIGMQRKLGSDIW
MRMNRPDGYSEMLSGYQPPNEGARNSQGFCSLPDQIAAGRPNFWHTVNAHYQDQQGNHNL
FPGSWSMMPSSTGFGMNRQSYPMIQEVGGMSQSCTNTKFGNGVYAALPGRGIDRYPSGWF
GHTTPGGRVDDAQPRVIKPQPLVLAHGEALKMKGNSCKLFGIHLDSPAKSEPLKSPPSVA
TPAAEKWMADGIDADKSPEPHKTPKQLGATQVDPVPERCPQASRGTQCKSQGGSTRSCKK
VHKQGMALGRSVDLTKFNGYTELVAELDEMFDFNGELKGCSKEWMVVYTDYEGDMMLVGD
DPWNEFCSMVHKIFVYTREEVQRMNPGALNSRPEDSGLANSTERGSASTAAAREAPGYQS
ASSLNSDNC
Download sequence
Identical sequences K7U085
GRMZM2G378580_T02|PACid:20857209 GRMZM2G378580_P02 NP_001307052.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]