SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G378580_P07 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G378580_P07
Domain Number 1 Region: 142-178
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000194
Family B3 DNA binding domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G378580_P07   Gene: GRMZM2G378580   Transcript: GRMZM2G378580_T07
Sequence length 192
Comment seq=translation; coord=4:23396120..23398028:-1; parent_transcript=GRMZM2G378580_T07; parent_gene=GRMZM2G378580
Sequence
MTSSAAAAAAAAQVAGGGGGGEGDAAAAARGGGGTEDGMYTELWNLCAGPLVTVPRVGDK
VYYFPQGHIEQVEASTNQVAEQHMQFYDLPWKILCEVMNVELKAEPDNDEVYAQLTLLPE
SKPEENGSSEEMPASPPAALARPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLVAC
WILDLILPVHQL
Download sequence
Identical sequences GRMZM2G378580_P07 GRMZM2G378580_T07|PACid:20857214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]