SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G390641_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G390641_P01
Domain Number 1 Region: 116-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-29
Family B3 DNA binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  GRMZM2G390641_P01
Domain Number - Region: 622-695
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0353
Family PB1 domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G390641_P01   Gene: GRMZM2G390641   Transcript: GRMZM2G390641_T01
Sequence length 700
Comment seq=translation; coord=6:88003120..88006321:-1; parent_transcript=GRMZM2G390641_T01; parent_gene=GRMZM2G390641
Sequence
MITFVDSAAMELERESGRCLVDPQLWHACAGGMVQMPPVHSRVYYFPQGHAEHAQGHAHA
DLPAGRVPALVLCRVDAVRFLADPDTDEVLARVRLAPVRPNEPDHADAAAPGAREDKPAS
FAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQTVLAKDVHGVVWKFRHIYRGT
PRRHLLTTGWSAFVNQKRLVAGDSIVFMRTGNGDLCVGIRRAKKGGIGGGPEFPHHQPPD
GGGYGYGYAGFSTFLRGEEDDAAARGKVRVLVRPEEVVEAANLAASGQPFEVVYYPRAST
PEFCVKAGAVRAAMRTQWCAGMRFKMAFETEDSSRISWFMGTVAAVQVADPIRWPNSPWR
LLQVAWDEPDLLQNVKRVSPWLVELVSSTPAIHHLTPFSPPSRKKLCIPLYPEGHQLPAP
MFHGSPLVGRGVGPMRYFPDGGTPPAGIQGARHAQFGISLPDLHHLTRLQSSLSPHAHGL
RHQLDHGARPRIAGGLIVGHPAARDDISCLLTIGTAPHKKPSDVKSAAAAPAPQLMLFGK
PILTEQQISLGFRPLPAPKKSPSDDAAETERTVSNNSDASSPAGTASGSTPSISGGAPSS
CQDNKAAATATATDDDDLLGHCKVFMQSEDVGRTLDLSAVASYEELYQRLADMFGVDRAE
LTSHVFYRDGASGALKHAGDEPFSEFTKTARRLTIQTDAR
Download sequence
Identical sequences K7UYC8
GRMZM2G390641_T01|PACid:20822408 GRMZM2G390641_P01 XP_008648196.1.34533 XP_008648197.1.34533 XP_008648198.1.34533 XP_008648199.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]