SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G393146_P03 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G393146_P03
Domain Number 1 Region: 5-540
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.96e-89
Family Acetyl-CoA synthetase-like 0.0000192
Further Details:      
 
Domain Number 2 Region: 760-981
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.2e-26
Family Quinoprotein alcohol dehydrogenase-like 0.0077
Further Details:      
 
Domain Number 3 Region: 554-616
Classification Level Classification E-value
Superfamily ACP-like 0.00000576
Family Peptidyl carrier domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G393146_P03   Gene: GRMZM2G393146   Transcript: GRMZM2G393146_T03
Sequence length 994
Comment seq=translation; coord=9:26427123..26433133:1; parent_transcript=GRMZM2G393146_T03; parent_gene=GRMZM2G393146
Sequence
MAAAEPCCISHAFERATRQEPGRLAVIHAAASGADSEERRFTCGDLLAAVGSLSRRIAAA
LGSTATDTRRDREQGSGFRAAGAVVPRVVGVYASPSLEYVAAVLAVLRCGAAFLPLDPSW
PEERVSWAISASNAALVVSSVGSRGATLFESSACPVLRFYGGIRRRFRDGNGGDDGEELV
WPCEHEWHRKFCYVMFTSGSTGKPKGVCGTEKDDVLLFKTSVSFVDHLQEFLSAVLTCST
LVIPPSEWRANPASLANLIKVYRISRMTLVPSLMEIILPTLAEKLSDGCNPLKILIFSGE
VLSVSLWKRVYEFLPEATIINLYGTTEVSGDCAFFDCKKLPTILEQEELNSVPIGFPISN
CEVSLVTNDGLSDEGEISVSGACLFTGYLADPMTSNCPEGSEVLAYYRTGDFARRLKTGE
LIFLGRKDRIVKIYGHRFSLEEVESTLRDHPDVSDAAVTFQSNGSLDFKAYLVLRSNNKF
LKCTQGYSGLHSSRDIIAPLRNWLIMKFPLAMVPRLFIPMKSLPLTLSGKIDYVKLSSLV
CAFEPCEIHPESSPADPHMQVIKKAFSDALLVHEVSEYDDFFSLGGNSITAAHVAHKLEI
DMRLLYIYTTPSKLFHGLLGEHSHVIPPTPEFHNRKKLRKYASISDSFGPVSEYLDSNFH
DQGQISKEGAYDHFAGNHVSDIDGQLSKSRTYNTYQAKNLCPDTCSNDEIFSGRPWILNF
HLQKVWSIGRCNRFMHGSEGMVHLEDICSYVPYNKKGYLVKIWSILLDSCVDASPLLVIN
NGMMSIFIGSHSYLFLCIDGYSGSVRWSVKLEGRIECSAAITGDFSEVVVGCYKGKIYFL
DMSTGKLSWTFQTDGEVKMQPVVDKMRNLIWCGSYDHYLYALNYKDRCCTYKVFCGGSIY
GSPAIDMAQNVIYVASTSGLVTAVSFKEPSFRVLWQYEAGAPIFGSLAIDHQSGTVICCL
VNGLVMTLNSQGSVVWKVIFLMHLVFIARGNVYA
Download sequence
Identical sequences GRMZM2G393146_T03|PACid:20840390 GRMZM2G393146_P03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]