SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G405170_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G405170_P01
Domain Number 1 Region: 24-132
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.14e-26
Family B3 DNA binding domain 0.0000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G405170_P01   Gene: GRMZM2G405170   Transcript: GRMZM2G405170_T01
Sequence length 224
Comment seq=translation; coord=10:53295776..53296451:1; parent_transcript=GRMZM2G405170_T01; parent_gene=GRMZM2G405170
Sequence
MALTTLALELESAAGDYSHSHSRRERMFEKVVTPSDVGKLNRLVVPKQFAERHLPLRGAA
ARSRGTVLCFHDDARGGEAWRFRYSYWSSSQSYVITKGWSRYVRDKRLATRDIVAFCRDG
ARLFIDCQRRRRTTTRRSGSEGAVVLPAPAIGAAVPPMCQLQMTVVFPDGQHQQAAVAMK
KETAAAQEEDDKEAQRRCGRCLRLFGVNLLDELRTEPLLLDLQL
Download sequence
Identical sequences K7UE08
GRMZM2G405170_P01 GRMZM2G405170_T01|PACid:20875712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]