SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G405699_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G405699_P02
Domain Number 1 Region: 230-313
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000051
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G405699_P02   Gene: GRMZM2G405699   Transcript: GRMZM2G405699_T02
Sequence length 313
Comment seq=translation; coord=6:263953..266834:1; parent_transcript=GRMZM2G405699_T02; parent_gene=GRMZM2G405699
Sequence
MGQMGGPDGDGPHHQYHYQALLAAVQNPSQGLHVPLHAGAGAPAAGPGPRPGADADASST
HNANATPHSQPPRAFTDWSASNSAFAAQPAPATTNTPFHYNLSQSYALWTHYMLNKNVSY
STYSTPHEPLRHTHIPDKYSGCAFSLGFDSFTTMSLGPNICANMTPMERSISAKEPENSE
DLPTVVRSSDEMDTRNSGDVRRDTVDTLPESKQSHESCASKFDSGEYQVILRKELTKSDV
ANSGRIVLPKKDAEAGLPPLVQGDPLILQMDDMVLPIIWKFKYRFWPNNKSRMYILEAAG
EFVKTHGLQAGDT
Download sequence
Identical sequences GRMZM2G405699_T02|PACid:20821689 GRMZM2G405699_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]