SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G405699_P03 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G405699_P03
Domain Number 1 Region: 97-180
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000145
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G405699_P03   Gene: GRMZM2G405699   Transcript: GRMZM2G405699_T03
Sequence length 180
Comment seq=translation; coord=6:263953..266834:1; parent_transcript=GRMZM2G405699_T03; parent_gene=GRMZM2G405699
Sequence
MLMPPPRIMPMPLPTLSLQELSLIGARPTVPLPHSPPLLPPIHPSTTTSPSLMPYGPITC
STRMYPTLLTLHHMSRCAIPTSRISIQKFDSGEYQVILRKELTKSDVANSGRIVLPKKDA
EAGLPPLVQGDPLILQMDDMVLPIIWKFKYRFWPNNKSRMYILEAAGEFVKTHGLQAGDT
Download sequence
Identical sequences GRMZM2G405699_T03|PACid:20821690 GRMZM2G405699_P03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]