SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G475882_P01 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G475882_P01
Domain Number 1 Region: 29-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-48
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 2 Region: 620-701
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000834
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G475882_P01   Gene: GRMZM2G475882   Transcript: GRMZM2G475882_T01
Sequence length 725
Comment seq=translation; coord=10:147258507..147267504:-1; parent_transcript=GRMZM2G475882_T01; parent_gene=GRMZM2G475882
Sequence
MHADVETDEVYAQMTLQPLNPQEQNDPYLPAEMGIMSKQPTNYFCKTLTASDTSTHGGFS
VPRRAAERVFPPLDFTQQPPAQELIARDIHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAK
RLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPSSVLSSDSMHIGLLAAAAHAAATNSRF
TIFFNPRASPSEFVIPLSKYIKAVFHTRISVGMRFRMLFETEESSVRRYMGTITEVSDAD
PVRWPSSYWRSVKVGWDESTAGERPPRVSLWEIEPLTTFPMYPSLFPLRVKHPWYSGVAA
LHDDSNALMWLRGVAGEGGFQSLNFQSPGVGSWGQQRLHPSLLSNDHDQYQAVVAAAAAS
QSDGYLKQQFLHLQQPMQSPQEQCNLNPLLQQQILQQGSQQQMVSPDAQNIQSVLNPNAI
QQQLQQFQQMQHAHNDQKQKIQPDQPYQVPSSAVLSSPTSLPSHLREKFGFSDPNVNSSS
FISSSSNENMLESNFLQGSSKSVDLSRFNQPVVSEQQQQQAWKQKFICSQSMSFGGSVSL
NSPTTKDGPVDNKIGRDVQNQTLFSPQVDSSSLLYNMVPNLTSNVADNNISTIPSGSTYL
QSPMYGCLDDSSGLLQNTGENDPTTRTFVKVYKSGSVGRSLDITRFSNYAELREELGQMF
GIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHKMGKPGND
PRYLS
Download sequence
Identical sequences A0A1D6JHR7
GRMZM2G475882_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]