SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G475882_P02 from Zea mays subsp. mays

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G475882_P02
Domain Number 1 Region: 113-259
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-30
Family B3 DNA binding domain 0.045
Further Details:      
 
Domain Number 2 Region: 706-787
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000981
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: GRMZM2G475882_P02   Gene: GRMZM2G475882   Transcript: GRMZM2G475882_T02
Sequence length 811
Comment seq=translation; coord=10:147260154..147267504:-1; parent_transcript=GRMZM2G475882_T02; parent_gene=GRMZM2G475882
Sequence
MSSSSAASIGQQPPEEEKKCLNSELWHACAGPLVCLPTVATRVVYFPQGHSEQVAASTNK
EVDGHIPNYPNLPPQLICQLHDVTMHADVETDEVYAQMTLQPLNPQEQNDPYLPAEMGIM
SKQPTNYFCKTLTASDTSTHGGFSVPRRAAERVFPPLVISHSSLQHRSLLHGIFMMSSGS
SGISSEASQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS
SVLSSDSMHIGLLAAAAHAAATNSRFTIFFNPRASPSEFVIPLSKYIKAVFHTRISVGMR
FRMLFETEESSVRRYMGTITEVSDADPVRWPSSYWRSVKVGWDESTAGERPPRVSLWEIE
PLTTFPMYPSLFPLRVKHPWYSGVAALHDDSNALMWLRGVAGEGGFQSLNFQSPGVGSWG
QQRLHPSLLSNDHDQYQAVVAAAAASQSDGYLKQQFLHLQQPMQSPQEQCNLNPLLQQQI
LQQGSQQQMVSPDAQNIQSVLNPNAIQQQLQQFQQMQHAHNDQKQKIQPDQPYQVPSSAV
LSSPTSLPSHLREKFGFSDPNVNSSSFISSSSNENMLESNFLQGSSKSVDLSRFNQPVVS
EQQQQQAWKQKFICSQSMSFGGSVSLNSPTTKDGPVDNKIGRDVQNQTLFSPQVDSSSLL
YNMVPNLTSNVADNNISTIPSGSTYLQSPMYGCLDDSSGLLQNTGENDPTTRTFVKVYKS
GSVGRSLDITRFSNYAELREELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWE
SFVNSVWYIKILSPEDVHKMGKPGNDPRYLS
Download sequence
Identical sequences GRMZM2G475882_P02 GRMZM2G475882_P03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]