SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000790 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000790
Domain Number 1 Region: 155-273
Classification Level Classification E-value
Superfamily EF-hand 1.05e-30
Family Osteonectin 0.00000146
Further Details:      
 
Domain Number 2 Region: 97-152
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000025
Family Ovomucoid domain III-like 0.0000752
Further Details:      
 
Domain Number 3 Region: 72-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000022
Family Follistatin (FS) module N-terminal domain, FS-N 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000790   Gene: ENSTGUG00000000770   Transcript: ENSTGUT00000000801
Sequence length 273
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:6471306:6483757:1 gene:ENSTGUG00000000770 transcript:ENSTGUT00000000801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWIFFLLCLAGKALAAPQEALPDETEVIEDPTTEKHQPVLQEPVGANPVQVEVGEFEE
PTEDVEEIVAENPCQNHHCKHGKVCEVDDNNSPMCVCQDPSSCPATAGVFEKVCGTDNKT
YDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKFIPACLDTELTEFPLRMRDWLKNVLITL
QHVGNGENTLLEVNNLRVKKIHENEKRLEAGDHTVELLARDFEKNYNMYIFPVHWQFGQL
DQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFE
Download sequence
Identical sequences H0YR82
ENSTGUP00000000790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]