SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000797 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000797
Domain Number 1 Region: 3313-3424
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-31
Family Cadherin 0.00046
Further Details:      
 
Domain Number 2 Region: 2262-2367
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-28
Family Cadherin 0.00059
Further Details:      
 
Domain Number 3 Region: 2787-2894
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-27
Family Cadherin 0.00083
Further Details:      
 
Domain Number 4 Region: 3763-3942
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.12e-27
Family Laminin G-like module 0.0081
Further Details:      
 
Domain Number 5 Region: 1128-1232
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-26
Family Cadherin 0.00043
Further Details:      
 
Domain Number 6 Region: 1015-1133
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-26
Family Cadherin 0.00049
Further Details:      
 
Domain Number 7 Region: 2054-2161
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-26
Family Cadherin 0.00085
Further Details:      
 
Domain Number 8 Region: 3001-3109
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-25
Family Cadherin 0.0005
Further Details:      
 
Domain Number 9 Region: 915-1020
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 1748-1868
Classification Level Classification E-value
Superfamily Cadherin-like 6e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 11 Region: 1545-1646
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 12 Region: 450-548
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-24
Family Cadherin 0.00079
Further Details:      
 
Domain Number 13 Region: 811-914
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-23
Family Cadherin 0.00057
Further Details:      
 
Domain Number 14 Region: 3412-3529
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-23
Family Cadherin 0.00087
Further Details:      
 
Domain Number 15 Region: 3103-3206
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-23
Family Cadherin 0.002
Further Details:      
 
Domain Number 16 Region: 2896-3007
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 17 Region: 704-824
Classification Level Classification E-value
Superfamily Cadherin-like 2e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 18 Region: 1433-1551
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 19 Region: 3207-3311
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 20 Region: 2471-2581
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-20
Family Cadherin 0.0018
Further Details:      
 
Domain Number 21 Region: 2368-2466
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 22 Region: 1228-1335
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 23 Region: 134-225
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-19
Family Cadherin 0.0019
Further Details:      
 
Domain Number 24 Region: 2161-2268
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-18
Family Cadherin 0.0011
Further Details:      
 
Domain Number 25 Region: 1652-1754
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-18
Family Cadherin 0.0023
Further Details:      
 
Domain Number 26 Region: 555-656
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-18
Family Cadherin 0.0023
Further Details:      
 
Domain Number 27 Region: 2569-2676
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-16
Family Cadherin 0.0023
Further Details:      
 
Domain Number 28 Region: 1856-1977
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000357
Family Cadherin 0.0026
Further Details:      
 
Domain Number 29 Region: 1963-2066
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000671
Family Cadherin 0.004
Further Details:      
 
Domain Number 30 Region: 2685-2794
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000171
Family Cadherin 0.0032
Further Details:      
 
Domain Number 31 Region: 1346-1445
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000113
Family Cadherin 0.0035
Further Details:      
 
Domain Number 32 Region: 359-456
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000757
Family Cadherin 0.0066
Further Details:      
 
Domain Number 33 Region: 3526-3617
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000628
Family Cadherin 0.0063
Further Details:      
 
Domain Number 34 Region: 25-146
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000757
Family Cadherin 0.0094
Further Details:      
 
Domain Number 35 Region: 3986-4026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.014
Further Details:      
 
Domain Number 36 Region: 3946-3982
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000013
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000797   Gene: ENSTGUG00000000776   Transcript: ENSTGUT00000000808
Sequence length 4364
Comment pep:known_by_projection chromosome:taeGut3.2.4:13:6519325:6562614:1 gene:ENSTGUG00000000776 transcript:ENSTGUT00000000808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSHFLSVAVFLMHCVVHKASCEKGNTSPLHFTHFFYNATIYENSAPKTYVESYVKMGIYK
RVPEWDIRYRIASGDSSGLFKTEEHVIGDFCFLRIRTRSSNTALLNREVKDSYMLIIKAT
ESTLAYEAWAKVLIHILDRNDLKPLFSPPSYKVSIREDTPLKTVISTLSATDADAGQNAE
FYYALSTKSNLFTVHPTTGAVMVTGRLNSTHRGRHNLQVLAVDRMRKITEGNGFGNLASL
TIQVEPSARKPPSISSVKMTSPDSDEDFIYATLSVESGDSEAGVDLVEFVDGDPGRHFKA
IKSYFGSTEFMIVSNKEINWLLYPFGFNLSVQAKDKSKPPLFSPVRVVHIPPSKYVSARF
EKEVYRVQLSEFSPAGSQVVMVKITPVVPNLKYILRPTPDSTSFKINPYTGLITTVRAMN
FHEQSSFELEVTSSISHTSTTVIVDIIDCNNHAPSFTQSSYHGAFDENVPPGTSVLTVKA
TDEDKGDNGFVTYSIANQKSVPFVIDPYSGVIFTSKSMDYELMQRWYHLRVWASDWGSPF
RHETEVYVSLTLSNVNDNAPVFEKASCSGTIPRDFPVGSPVATVSAIDSDELQHIKYEIK
SGNELQHFELNPISGVISLRISLRDLPSEQPLFYSLKITATDGENYALPTSVNITVVSQG
LPVKMQCEETGVLKQLTETIIHSIESQSQGHGQDDETSLNLHLINHNAPKFDDSFPRSID
IIETVPINSTIADLSATDPDTGFSGKLVYVISDGNDDSCFTIDLERGLLQVLSPLDHEQT
SFYILNITVYDLGTPQKSSWKLLAVNVLDTNDNTPKFTQASYWVAIPEHVAAGTTIAQLK
AEDADTDDNGRVKYSLLTPTDKFAINSVTGEVTVTGALDRELWPCYVLKIEARDQPKTGF
QLFSVTDLIVTLEDVNDNTPQCLPALNSVKVPEDLPVGTILLFLEAFDPDAGSGGEVRYS
LINNEEMMFHVDKLTGALRLEKELDYEKRDSYNLTVQVSDGGKPFSRSSLCHLEVNVIDV
NENLNPPRFASFIFKGWVQENSPKGTSVMMVTAKDIDRGKDGEVQYFLREGTGLSVFHIE
KDTGTIRTIGSLDREGTSHYWLTVLALDLGTIPLSSVTEIYIEVTDTNDNPPQMSRPVFY
ASVMENSPPNTSVLQLDAFDPDSSSEGKLTFHILTGNLQGLFTINLSTGLISTTSRQLDR
EYKAEHILEVAVSDNGEPALKSSSRVVIQVLDANDSPPSFPHKLFMVQLPEREASETPLP
VYRLIASDRDQGQNSQITYTIEEEEEGIFTINPTTGTVFSRKAFPASEYNILTVKATDGG
SPPLSSHVRLHISWVTRPGPSSEPLAFDEPHFNFAVMETDPVNHMVGVISIEMGPSQVWF
NITGGDDDMDFDIEKSTGSMVIARPLDARKKSSYNLTVEVTDGSSTIKTQAFIHVIDINQ
HRPQFLQSHYEVRVPEDTPSGREILRVSATDKDKGKGLIYTIHGSVDPKSTRLFQLDPGN
GVLTTAEGFSSQPMPQHTLTVMVRDQEVPIKRNFVRVIVHVDSCNLHPPQFSSIHYEAEV
LDSAVVGTEVIQVRALDQDQGANAEIRYSLQAGNGEGFFSIDPYSGIVTVAQKLDPSRQE
RFTLIVKAEDQGFPQLKDSATVHVHIRPSDRTPPKFLEAEYITEISESTAIGSPLIQVSA
TSLSPVSYEIKDGNGDGVFSMNYQSGLISTQKNLDFEQVSFYQLKVRGTNMAGAFMDAVV
LIYVIDENDNVPVFVKPSFVGWIMENAPAQSMVLDESNAPLVTYATDADQDSNALLIYEI
LEPEALKYFTVDPSTGTLTSRADIDYELTPVFHFSVHVHDSGSPSLFASKPAKVTIHVKD
VNDSPPVFLKDIYDVSVLLPAHPGMELLSVQAKDADSEVTYSIVEGNLDNAFHIHPLTGL
ISILNTSGLRSYQELTVRAGDGLYKSTALVKLNLTRAQGTSLKFDQDVYTATIMENSSDE
KTLTILGVKGYQLNEPLSYSLLNEKERFKIIQASGVLQTKGVKFDREMQDMHEVAVEVKD
SRKPPRVSQATVRVYVEDVNDNPPQFENVPYYATVQDGTEPGDVLFQVSATDKDIGDNGA
VTYSFAEEYKYFRIDPYLGDISLKRPLDYQALNKYNLRVIAKDKGEPPLHAEEEVVISVR
NRSNPLFQSLYYRVKVPENVPPYTSILHIQARSPEGLRLIYNIVEEDSLKLFNTDFKTGV
LTVTGQLDYELETKHTFTVRATDTALGSFSEARVEVEVEDINDNPPIFSQIIYTASVSES
LPPQTPVVQLFASDKDSGRNKVVSYQIMDDGSDAAKFFNIDASTGHITTAQALDYETNQQ
FRMKVRAADHGVPPLSSDALVIVDVTDINDNPPEFSQLQYEAKVSEMATCGHIVIKVQAL
DPDSGDTTRLEYVILSGNDNRHFAINSTSGIISMFNRCKKDLEPSYNLRVSASDGVFKST
VPVYINTTNANKYSPTFQQNVYEAELAENAEIGTKVIELLAIDPDGGPYGTIDYTIINKL
AHEKFSIDNKGCIATLQKLDRENSTERVIAIKVMAKDGGGKVAFCTVKIILTDENDNPPL
FKASEYTLSIQSNVSKGSPVIQVLAYDADEGANADVIYSVDSVEDVTEDLVEINAATGVV
KVKESLIGLENRAFNFKVKAEDGRPPHWNSLVPVNLQIVPREVTLPRFSEPLYTFSASED
LPEGSEIGSVKAFAEDPIIYSLVKGTTTESNKDEVFTLDEQTGALKIKKPMDHETTKWYQ
VDVMAHCSHLETELVSLVSVNIQVQDVNDNRPVFEADPYRAFVMENMPSGTTVIQVTAND
QDTGSAGQVTYSLEAESGNLRGLFTIDGESGWITTLKELDCEDQEIYRFYVVATDHGRKV
QLSSQTLVEVTVSDENDNAPQFTSDFYKGSVIENAEPGQVIVTLSTIDADISEQNRRVTC
YITEGDILGQFTVEQIEGEWTISSKKPLDREDTEKYLLKVVASDGKFQATTEVEIFVLDI
NDNSPECGQILYTGRVSEDAGPGLLILKISATDPDVGSNAQITYSLHGPGAEEFRLGPHT
GELSTSASLDREQKPTYHLVAKATDGGGRSCQADVTLIIEDTNDNAPRFFPSHCAVAVFD
NTTTKTPIAVVAARDLDEGLNAEVVYSLSDSANGHFSIEETTGVIRLEKPLKDSQHSAFE
LTVCATDRGTPQPLSSLGTVTVSVVDLNEYLPVFLAPEYVAMVKEDVAVGTEVLNLSVLT
RDNAENNEIKYEIVNGNDHGKFQLNPNTGALYINGSLDFEVSHEYYLSIEGTRKGSASLS
DVTMVVINITDINDHAPEFIQDPYFTDIREDAAIGEIILTVSADDLDGSMNNQITYSIVE
GNPLGHFAIQPKNGQISIAKHLDREEIPSYALTVRATDNGHPAQFSDVPVHVHVSDVNDN
PPRFFQLNYSVVVQENAPVGTSVLELIMSDRDSPENGPPYSFQITQGNDGKAFEVTQNGL
LVTSSVLNRRMKEQYLLQVQVSDSGIPPLSSSAFINIQVTEQSQYAPSALPLEIFITTNE
EAFRGGVLGKIHATDRDPHDTLVYTLVAQVPKEGLFSVGAADGKIIAGDKLPHGHYLLNV
TVSDGTFTATTSVSVHVWCFTQEALDKAVVLHFRHLSPEEFVGDHWRNLQRFLGNILVTR
RQNIHMASLQPAAASDGVDLLLAVGEPHGSLYEPRVLASKLTGSAGEMDQLVGLRMKKAI
HVPCHGSDCAHRVCRETIQLDPGMMSTYSTARLSVLTPRHSLEQICSCNGTAVRFGGHSY
IWYQHSQAGSWHMHFRLKTHQHHSVVFHANGSDHTTLEMVNGVPQLGYSCQGSSSGNLSS
SRFVSDGEWHSVFLEVKNNSVRLLIDGLGNASLQLPGTCGISQGRRDLIFGGLRQSLQSQ
RVARGFRGCLDVVAINGREVVLLPGKGQSKEVLEEVGIRQCCSPTGACSSNPCLNNGMCS
ETHGGGYTCICPGLFSGEHCELGDSPCESKPCLHGGTCTLSATGYSCHCPDWYLGERCEK
LAEECQGAYCTQPIITPAIVPTQWALGPEEMAEIAAGVLGAAILAAAFVLVRKRCRQRAK
AHKPVAREDPDLLSKSEFSKSVGVGTQPVPPIELNILSDAPHNNLDRATPEQRKATGTPE
FVTFNSANAPKHRGTIVCSVPQPAPRCTPSNSDNESFIKCTWAREEMVYPAETTYWPPRY
LSSDVQEYSHYEIIQGPPASSSHPPLPPPPPPPADTEPVALYGGFPFPLDQSNKRAPIPP
RYSNQNLEDFLPLGPVDMGASQCQNEYTAISYYPAQLVQGEGVPYQPEPGYKRVSMRLSV
AQPSYADCELGHQPSIRAQPLPPPNYEGSDMVESDYGSCEEVMF
Download sequence
Identical sequences H0YR89
59729.ENSTGUP00000000797 ENSTGUP00000000797 ENSTGUP00000000797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]