SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001354 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001354
Domain Number 1 Region: 1284-1393
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-40
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 2 Region: 700-809
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-37
Family Spermadhesin, CUB domain 0.00014
Further Details:      
 
Domain Number 3 Region: 354-466
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-37
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 4 Region: 2224-2337
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-36
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 5 Region: 2462-2573
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-36
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 6 Region: 821-925
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-35
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 7 Region: 472-584
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-34
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 8 Region: 2000-2108
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-34
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 9 Region: 931-1044
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 10 Region: 1160-1275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-33
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 11 Region: 2811-2922
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-33
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 12 Region: 2928-3052
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-33
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 13 Region: 1512-1623
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-33
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 14 Region: 3168-3280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-32
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 15 Region: 1406-1508
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-32
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 16 Region: 1632-1738
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-30
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 17 Region: 1054-1157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-29
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 18 Region: 2108-2218
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-29
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 19 Region: 1864-1985
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-28
Family Spermadhesin, CUB domain 0.00077
Further Details:      
 
Domain Number 20 Region: 3284-3397
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-28
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 21 Region: 1760-1863
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-28
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 22 Region: 2689-2811
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-28
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 23 Region: 593-694
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-27
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 24 Region: 3059-3168
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-26
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 25 Region: 2343-2458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-26
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 26 Region: 2577-2692
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-23
Family Spermadhesin, CUB domain 0.00081
Further Details:      
 
Domain Number 27 Region: 238-350
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-22
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 28 Region: 196-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000241
Family EGF-type module 0.01
Further Details:      
 
Domain Number 29 Region: 65-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000383
Family EGF-type module 0.016
Further Details:      
 
Domain Number 30 Region: 24-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000229
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 31 Region: 157-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000328
Family EGF-type module 0.026
Further Details:      
 
Domain Number 32 Region: 116-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000196
Family Merozoite surface protein 1 (MSP-1) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001354   Gene: ENSTGUG00000001311   Transcript: ENSTGUT00000001367
Sequence length 3397
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:21974685:22109468:1 gene:ENSTGUG00000001311 transcript:ENSTGUT00000001367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPKYHCVCDSGWMSPPGSPACSADIDECSLPDPPCSQDPLVECYNTLGSYRCGPCPTGWK
GNGYTCQDIDECASNNGGCSTVPMVQCINTVGSFRCGLCPPGYEGDGKTCTQVDICSINN
GGCHPLATCTSAPGPMAFCSCTSGFTGSGYGPNGCSPLSDICQLQNPCANGQCLAMISGY
FCLCNAGWTGPNCTENIDECISNPCQNGGTCTDGVNGYSCECTSAWTGPQCQTAQQVCGG
FLSALRGSFSYPNNPNSQWYSSEVSCAWVIQTTPNKILRVTFPFFQLETSNQCNSEFLQI
HDGPSASMHMLGKYCGFPGPTELLSSHNSLYFWLYSNHTITGGFTVHWESQDPECGGELT
GTYGLITSPGYPGNYPVNRNCFWTISTSPGLLITFVFGTLSLEDHDNCDYDYLEIRDGLL
PQDPVLGKYCSTGSPPPLQTTGPYAFIHFHSDDSLTDKGFHIMYTTSPADPSCGGNFTES
EGVITSPFWPNPFINNRQCVYIIRQPEDEKIFLNFTHMELESHHGCSANYIEVRDGDSEM
SPLIKKICHNTVTSAITSTSNSLWIKFKSDASVQRTSFRAIYQVACGGFLSGAGTIHSPY
YPRMSSHPKTCEWIISQPATKAVILNFTDFDIRNTTTCDSDYIEVRDGNNGDSPVLEKYC
GTAVPSRVQSTRNNLYIKFRASSLTNLGFRAQYWPLDTVCGETLTGPSGTITSPGYPDVY
PHGINCTWIINIQPGYFIRLTFTSFNLAFDYSCRKDYLEIYDNSTEQKLGRYCGRSIPPS
LTSGGNMMTLSFMTDHSIASEGFSANYISLDASKVCSHNYTSDTGTLTSPNYPNNYPVQT
ECTYTITVGMNRHIVLSFTNFTLEGNKRCTEDYVEIRDGGYETSPPLGKYCGTDLPPVII
SHGNKLWIKFVSDVFGTREGFSAEWDGTSAGCGGTFIASSGILMSPNYPMPYYHNSECYW
LLKGNRGSPFEIQFEQFHLEHHQKCSFDYLAIYDGNSSNAKQLGKFCGDQIPQTIHSSGD
SVYLKLRTDNSLQGGGFLAKYKQVCHEVLTVNRSHGILESLNYPNNYPLNEHCNWTIQTT
KGNTLNYSFTAFDLEDGSDCDRDFLKIYDGPDAQSNLIGTFCGQSLPLAGSTTGTSLHVE
FYSDGLNARSGFQMLWHVDGCGGELSGPSGSFHSPGYPSRYPSNRECIWYIHTAPGSSIQ
LTIQEFDIEYHPNCSYDVLEVFGGPDFLSPRLAQLCVSRSAQNPLRVSTTGNSAIVRFET
DAAGTGKGFNASWQENPGGCGGIFQATSGEIYSPNYPQPYNNNTDCSWVIQVDQSHRVLL
NFTDFDIENHHSCNYDNVEVFDGPNNEAPLLEKLCGTQHPPPITSSRNLMYIRLHSDNTI
QHRGFSARFTEACGSFIESDSVGAAISSPLYPAKYPNNQNCSWIIQAQEPFNHVTLSFTD
FDIEKNGQNCTTDFLEILDGNNYEAPLQGRYCGTTMPHPITSFGNALVVNFISNNDVTAR
GFHATYAASSSSCGGTFHMDRGAFNSPGYPEPYPLDSECVWTILSSPGNRLQLSFIAFQL
EESSGCTKDYLEIREGSDTGTLTGRFCGSSFPSNYTSTVGHILWVKFVSDSSGTDVGFRA
TFSHLYGNDIVGDRGQIASPQWPRSYPHNSNYQWRISVNASQVIHGRILQMDLENHHRCH
YDNLKVYDGPTVHSRLVATYCGADLASFASSGSSMTIQFQSDSSVTGKGFLLEWYAVDAS
AVTHTIARGACGGSVTTEETPSFLFSPSWPMNYRNLEDCMWLIRAPGSTVEFNILALDIE
SHSSCNYDKLIIRDGDNILSPVLATLCGREPPGPIRSTGDAMLIHFMSDASVTGAGFNAS
YHKSCGGYLHTSRGVITSPNYPQNYSPNLNCSWHVVVATGFIIAVHFEQPFQIKSEDTSC
ILGDYVELKNGLDDAAPPLVSARGNGRFCGSSPISTMYTTDNQLFVHFTSDSRNEGQGFK
LKYEAKNLACGGNIYISDFNPSGYTSSPNYPSNYPPHADCVWTISAPNGHAVELQFEDQF
YIEPSPNCTSSYLELRSGADSSAPLIAKLCGGLMPGSQRSSGAVMYLRFRSDNSATHVGF
NAKYSIAPCGGTVTGQTGIIESTGYPDLHYQDNLLCEWFLQGPRGHYLTIRLEGLDIQNS
YGCTNDFVEIREYNASGNLLGRYCGNTLPDAVDTSDSFAYVKFVTDGSVNARGFRLRFDS
STEECGGDLTAPVGTFTSPNYPNLYPHNRVCEWRITVGEGRRVTLTFNDMKTEEHWSCSS
DYVAVYNGLEQNSPQLAKLCGEVNPGTEVKSTGNTMKVILVTDMSRAARGFSVSYTSSED
AVCGGILMAHAGGNFSSPGYDGIRNYTSNLNCEWTIENPSHYNSSMYISFEDFHLEHHQS
CQYDYLELRIGDADGELIARLCGQAAPSVPLVIAAPQVWVQFVSDENTEDKGFLAHYTYE
ACGGVQSGEWGVISSPNYPEPYSNLNHCSWVLEAPEGETITLTFTAFHIENHSLCNWDSV
TILNGGSPGSPVIGTYCGNNSPGTIRSGSNKLVIIFNSDHSVQGGGFYATWTAESLGCGG
IIHSDNGTIKSPHWPQNFPMNSRCTWTIITHESKHLEVNFHRNFQIPDSNGSCQTSYVKV
WRGNNEEEAAALLATGCGSSAPDPVVAPNNVITTVFQSQDAPAPGFSASFTSRCGVNFTG
PEGRIVSPNYPSQYDNNLNCNYIIDQGPQSLVILEFETFDLEAPALLSRICLYDGVSIFS
GKSTAAHPLITLCGNQLPDPVSVFGPMLLNFYTDSHIVGFGFQARYRAIACGGIFSGSNG
VISSPGHSRLDYHNNMNCSYHITVGNGKAVALKFNSFQLELSPSCYKDYVAVYDGSDTHA
PLLGKFCGSELPPNIKSSSNNLFLVFSTDFYGADRGWKASFREALGPQNGCGGYLSSSAS
TFGPPISNVTRRYEKNLDCVWIITAPVNKRINLTFTSFQLEAQSAWICRYDYVKLYDGEN
ENANLVGTFCGSRVPAPFLSTRNFLTVKFVTDNYVERMGFNVTYTTVDRLCGGIYNATST
SLTATSPNFPNEYPPFTLCSWVIDAPPQQQVRVVVETFHLHSSQDCSQNYLELQDSPTQS
QGSVHRFCGTETFPVPEFYSYDRTAIVTFKSDEYMINNGVRFSYQATGCSREYNQTFGYL
KSPGWPGQHPNNMDCSIILRAPQNHTISLFFHAFSLEDSIHCSHDFLEVRNGSDVQSPLL
GRFCGNTVPSPIFPQNHVVYLRFKSDFSMAHDGYEITWTSSSSGCGGTLYGTTGSFASPS
YPGTYHNNTDCEWAITAPQGRIVTVNFDFISIDDPGDCSSNYLILYNGPDASHAPAGPYC
GTDTNIAPFTATSHQVYIKFHAEYVTLPSGFQLSWTS
Download sequence
Identical sequences H0YSU3
59729.ENSTGUP00000001354 ENSTGUP00000001354 ENSTGUP00000001354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]