SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001495 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001495
Domain Number 1 Region: 1133-1349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-38
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 219-331
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-31
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 324-429
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-29
Family Cadherin 0.00092
Further Details:      
 
Domain Number 4 Region: 635-747
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-28
Family Cadherin 0.00081
Further Details:      
 
Domain Number 5 Region: 6-109
Classification Level Classification E-value
Superfamily Cadherin-like 9.95e-27
Family Cadherin 0.002
Further Details:      
 
Domain Number 6 Region: 111-217
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 7 Region: 740-841
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 526-630
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-24
Family Cadherin 0.0022
Further Details:      
 
Domain Number 9 Region: 429-530
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.0009
Further Details:      
 
Domain Number 10 Region: 843-945
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000196
Family Cadherin 0.035
Further Details:      
 
Domain Number 11 Region: 1615-1658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000891
Family EGF-type module 0.031
Further Details:      
 
Domain Number 12 Region: 1579-1612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000097
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001495   Gene: ENSTGUG00000001444   Transcript: ENSTGUT00000001508
Sequence length 1940
Comment pep:known_by_projection chromosome:taeGut3.2.4:26:3083144:3105650:1 gene:ENSTGUG00000001444 transcript:ENSTGUT00000001508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPNTAPQFQPSSYQATVEENQPARTPVTQVTAQDPDEGEAGRLHYSMAALFDSRSNDLF
TVDPVTGAISTAAPLDRESKSTHVFRVIAVDHGTPRRSAMATLTVTVSDTNDHDPAFEQL
EYRESVRENLEVGYEVLTVRATDGDAGPNANILYRLLNAGDANEVFEIDSRSGVIRTRGP
VDREVVDTFELLVEATDQGQDPGPRSATATVRIAVEDDNDNAPQFSERRYVAQVPEDVVP
NVAVLQVMATDRDKGSNALVHYSIVSGNTRGHFYIDAQTGALDVVTPLDYEVTKEFTLRI
RAQDGGRPPLSNISGLVTIQVLDVNDNAPIFVSTPFQATVLENVPVGYSVIHVQAIDADS
GDNSWLVYTLLETGTGFPFTINNSTGWIVVASELDREVVDFYSFRVEAQDHGTPSMASTA
SVSVTILDVNDNSPEFTQREYSARLNEDAAVGTSVLTVSAVDRDAYSIITYQISSGNTRN
RFSITSQSGGGLISLALPLDYKLERQYLLTIAASDGTRHDTAQVVVNVTDANTHRPVFQS
SHYTINVNEDRPVGTTVVVISATDEDTGENARITYLMEDSIPQFSIAADTGAVTTQMELD
YEDQVSYTLAITARDNGIPQKSDTTYLEILVSDVNDNAPQFLRHSYQGSIYEDVPTFTSV
LQVSATDRDSGLNGRVFYTFQGGDDGDGDFIIESTSGIVRTLRRLDRENVPLYCLRAFAM
DKGIPARRTPVEIQVTVLDVNDNPPVFERDEFDIFVEENSPIGLVVARITATDPDEGTNA
QIMYQIVEGNIPEVFQLDIFSGELTALADLDYETKAEYIMVVQATSAPLVSRATIHVRLC
DTNDNSPQLKNFEILFNNYITNRSSSFPGGIIGRIPAYDPDVSDHLTYAFEQGNELNLVL
LDPHTGDLRLSPALDNNRPLEAIMRVSVSDGVYSATAQCTLRVTVITDEMLSNSITLRLA
DMSQERFLSPLLSRFLEGGADKVGVIFLCFPMGNWEVGYPFWGIKRCLGDKGGRGGSPPP
FPLRVLGVTLGSSVSAWGENSGVTGGWGGERTPSPHFWGAGAMRVSHKGALQAEHLRGAT
PGLMGRCGGRWDSLFQFWGSECQTGEHCELSARGGRCTPGVCRNGGTCLNLLVGGFRCQC
PPGHYEKPFCTMSTRSFPPHSFLTFRGLRQRFHFTLGLTFATQERDGLLLYNGRFNERHD
FVALEIVDEQLQLTFSAGETTSTVSPFVPGGVSDGQWHRVQLHYYNKPAVGRLGVPQGPS
EQKVAVVTVDDCDTAMALRFGPRLGNYSCAAQGTQTGSKKSLDLTGPLLLGGVPTLPESF
PIRSRHFVGCMRHLHIDQRPVDMSAFIANNGTLPDLPAPRRGGLSPKLDRGGSHSHSWAS
QPHASPLHFPLVLCKPEFLNHTQTLNSTVTPWYPVSPRVQNWLTYLLFPFLVSDSVMTLG
MSSKTLAIAWHLPQGARTLGPSGHGLPTGVAKKSPGHSLGAGPGPVPEAAGGAKGGPDLP
AGVPVSGQRRSPGHGGPGCSGSHPSQSTVGMQPGPAHQLRHGVLTLQGLRVGDPVVTAGA
LSLAQAVQVNVEGGCALPDPCDSGPCPPHSYCSDDWDSFSCRCHPGYFGDSCVSACALDP
CEPPGTCTHRPGTAPGYTCHCPPGTFGALCQHRLDGCARGIIARARAVVDVKMASNVEKV
TIECHCHPVSPFTPTPWLLVLCHPVSPCVTLCHPVSPWVPVPGAIATLLSPCIPHFDAVL
CLAVNYDSCPRAIEASIWWPRTRFGLPAAAPCPKGSVGTALRHCDEHKGWLPPNLFNCSA
LAFAALRPWAEQLLANESQWDAGQSRRVALALREAMREAQGYFGSDVHLAYHLAGALLRH
ESRQHGFRLAATQDVHFTENLLRVGSALLDMGNKRHWELIQQTEGGTAQLLQHFEDYAQA
LARNMPQTYLSPFTIVTPNI
Download sequence
Identical sequences H0YT83
ENSTGUP00000001495 59729.ENSTGUP00000001495 ENSTGUP00000001495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]